• Gene id: 7163

Gene Summary

• Gene Symbol: TPD52   Gene   UCSC   Ensembl
• Aliases: D52, N8L, PC-1, PrLZ, hD52
• Gene name: tumor protein D52
• Alternate names: tumor protein D52, prostate and colon associated protein, prostate leucine zipper, protein N8,
• Gene location: 8q21.13 (80171563: 80034744)     Exons: 12     NC_000008.11
• OMIM: 604068

Protein Summary

• Protein general information: P55327  
  • Name: Tumor protein D52 (Protein N8)
  • Length: 224  
  • Mass: 24327
  • Tissue specificity: Isoform 2 is expressed in colon, breast, prostate, pancreas and kidney tumor cell lines. Isoform 2 is expressed at high levels in kidney, prostate, brain, small intestine and pancreas, at moderate levels in placenta and colon, at low l
• Sequence:

  MDCREMDLYEDYQSPFDFDAGVNKSYLYLSPSGNSSPPGSPTLQKFGLLRTDPVPEEGEDVAATISATETLSEEE
  QEELRRELAKVEEEIQTLSQVLAAKEKHLAEIKRKLGINSLQELKQNIAKGWQDVTATSAYKKTSETLSQAGQKA
  SAAFSSVGSVITKKLEDVKNSPTFKSFEEKVENLKSKVGGTKPAGGDFGEVLNSAANASATTTEPLPEKTQESL

• Structural information:
  • Interpro: IPR007327  
  • STRING: ENSP00000429309
• Other Databases: GeneCards:  TPD52  Malacards:  TPD52

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0009653	anatomical structure morphogenesis	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005737	cytoplasm	IDA	cellular component
GO:0005783	endoplasmic reticulum	IDA	cellular component
GO:0005509	calcium ion binding	IDA	molecular function
GO:0005737	cytoplasm	IDA	cellular component
GO:0048471	perinuclear region of cytoplasm	IDA	cellular component
GO:0042803	protein homodimerization activity	IDA	molecular function
GO:0046903	secretion	TAS	biological process
GO:0030183	B cell differentiation	IEP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881