• Gene id: 7162

Gene Summary

• Gene Symbol: TPBG   Gene   UCSC   Ensembl
• Aliases: 5T4, 5T4AG, M6P1, WAIF1
• Gene name: trophoblast glycoprotein
• Alternate names: trophoblast glycoprotein, 5T4 oncofetal antigen, 5T4 oncofetal trophoblast glycoprotein, 5T4 oncotrophoblast glycoprotein, wnt-activated inhibitory factor 1,
• Gene location: 6q14.1 (82362982: 82367419)     Exons: 4     NC_000006.12
• Gene summary(Entrez): This gene encodes a leucine-rich transmembrane glycoprotein that may be involved in cell adhesion. The encoded protein is an oncofetal antigen that is specific to trophoblast cells. In adults this protein is highly expressed in many tumor cells and is ass
• OMIM: 609315

Protein Summary

• Protein general information: Q13641  
  • Name: Trophoblast glycoprotein (5T4 oncofetal antigen) (5T4 oncofetal trophoblast glycoprotein) (5T4 oncotrophoblast glycoprotein) (M6P1) (Wnt activated inhibitory factor 1) (WAIF1)
  • Length: 420  
  • Mass: 46032
  • Tissue specificity: Expressed by all types of trophoblasts as early as 9 weeks of development. Specific for trophoblastic cells except for amniotic epithelium. In adult tissues, the expression is limited to a few epithelial cell types but is found on a va
• Sequence:

  MPGGCSRGPAAGDGRLRLARLALVLLGWVSSSSPTSSASSFSSSAPFLASAVSAQPPLPDQCPALCECSEAARTV
  KCVNRNLTEVPTDLPAYVRNLFLTGNQLAVLPAGAFARRPPLAELAALNLSGSRLDEVRAGAFEHLPSLRQLDLS
  HNPLADLSPFAFSGSNASVSAPSPLVELILNHIVPPEDERQNRSFEGMVVAALLAGRALQGLRRLELASNHFLYL
  PRDVLAQLPSLRHLDLSNNSLVSLTYVSFRNLTHLESLHLEDNALKVLHNGTLAELQGLPHIRVFLDNNPWVCDC
  HMADMVTWLKETEVVQGKDRLTCAYPEKMRNRVLLELNSADLDCDPILPPSLQTSYVFLGIVLALIGAIFLLVLY
  LNRKGIKKWMHNIRDACRDHMEGYHYRYEINADPRLTNLSSNSDV

• Structural information:
  • Protein Domains: (53..9-)
    (/note="LRRNT-)
    (283..34-)
    (/note="LRRCT"-)
  • Interpro: IPR000483  IPR001611  IPR003591  IPR032675  IPR000372  
  • Prosite: PS51450
  • PDB: 4CNC 4CNM 6HBY
  • PDBsum: 4CNC 4CNM 6HBY
  • STRING: ENSP00000358765
• Other Databases: GeneCards:  TPBG  Malacards:  TPBG

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0016020	membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005887	integral component of plasma membrane	TAS	cellular component
GO:0007155	cell adhesion	NAS	biological process
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0051965	positive regulation of synapse assembly	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0009986	cell surface	HDA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881