• Gene id: 7155

Gene Summary

• Gene Symbol: TOP2B   Gene   UCSC   Ensembl
• Aliases: TOPIIB, top2beta
• Gene name: DNA topoisomerase II beta
• Alternate names: DNA topoisomerase 2-beta, DNA topoisomerase II, 180 kD, DNA topoisomerase II, beta isozyme, U937 associated antigen, antigen MLAA-44, topo II beta, topoisomerase (DNA) II beta 180kDa, topoisomerase II beta, topoisomerase IIb,
• Gene location: 3p24.2 (25664890: 25597904)     Exons: 36     NC_000003.12
• Gene summary(Entrez): This gene encodes a DNA topoisomerase, an enzyme that controls and alters the topologic states of DNA during transcription. This nuclear enzyme is involved in processes such as chromosome condensation, chromatid separation, and the relief of torsional str
• OMIM: 126431

Protein Summary

• Protein general information: Q02880  
  • Name: DNA topoisomerase 2 beta (EC 5.6.2.2) (DNA topoisomerase II, beta isozyme)
  • Length: 1626  
  • Mass: 183267
• Sequence:

  MAKSGGCGAGAGVGGGNGALTWVTLFDQNNAAKKEESETANKNDSSKKLSVERVYQKKTQLEHILLRPDTYIGSV
  EPLTQFMWVYDEDVGMNCREVTFVPGLYKIFDEILVNAADNKQRDKNMTCIKVSIDPESNIISIWNNGKGIPVVE
  HKVEKVYVPALIFGQLLTSSNYDDDEKKVTGGRNGYGAKLCNIFSTKFTVETACKEYKHSFKQTWMNNMMKTSEA
  KIKHFDGEDYTCITFQPDLSKFKMEKLDKDIVALMTRRAYDLAGSCRGVKVMFNGKKLPVNGFRSYVDLYVKDKL
  DETGVALKVIHELANERWDVCLTLSEKGFQQISFVNSIATTKGGRHVDYVVDQVVGKLIEVVKKKNKAGVSVKPF
  QVKNHIWVFINCLIENPTFDSQTKENMTLQPKSFGSKCQLSEKFFKAASNCGIVESILNWVKFKAQTQLNKKCSS
  VKYSKIKGIPKLDDANDAGGKHSLECTLILTEGDSAKSLAVSGLGVIGRDRYGVFPLRGKILNVREASHKQIMEN
  AEINNIIKIVGLQYKKSYDDAESLKTLRYGKIMIMTDQDQDGSHIKGLLINFIHHNWPSLLKHGFLEEFITPIVK
  ASKNKQELSFYSIPEFDEWKKHIENQKAWKIKYYKGLGTSTAKEAKEYFADMERHRILFRYAGPEDDAAITLAFS
  KKKIDDRKEWLTNFMEDRRQRRLHGLPEQFLYGTATKHLTYNDFINKELILFSNSDNERSIPSLVDGFKPGQRKV
  LFTCFKRNDKREVKVAQLAGSVAEMSAYHHGEQALMMTIVNLAQNFVGSNNINLLQPIGQFGTRLHGGKDAASPR
  YIFTMLSTLARLLFPAVDDNLLKFLYDDNQRVEPEWYIPIIPMVLINGAEGIGTGWACKLPNYDAREIVNNVRRM
  LDGLDPHPMLPNYKNFKGTIQELGQNQYAVSGEIFVVDRNTVEITELPVRTWTQVYKEQVLEPMLNGTDKTPALI
  SDYKEYHTDTTVKFVVKMTEEKLAQAEAAGLHKVFKLQTTLTCNSMVLFDHMGCLKKYETVQDILKEFFDLRLSY
  YGLRKEWLVGMLGAESTKLNNQARFILEKIQGKITIENRSKKDLIQMLVQRGYESDPVKAWKEAQEKAAEEDETQ
  NQHDDSSSDSGTPSGPDFNYILNMSLWSLTKEKVEELIKQRDAKGREVNDLKRKSPSDLWKEDLAAFVEELDKVE
  SQEREDVLAGMSGKAIKGKVGKPKVKKLQLEETMPSPYGRRIIPEITAMKADASKKLLKKKKGDLDTAAVKVEFD
  EEFSGAPVEGAGEEALTPSVPINKGPKPKREKKEPGTRVRKTPTSSGKPSAKKVKKRNPWSDDESKSESDLEETE
  PVVIPRDSLLRRAAAERPKYTFDFSEEEDDDADDDDDDNNDLEELKVKASPITNDGEDEFVPSDGLDKDEYTFSP
  GKSKATPEKSLHDKKSQDFGNLFSFPSYSQKSEDDSAKFDSNEEDSASVFSPSFGLKQTDKVPSKTVAAKKGKPS
  SDTVPKPKRAPKQKKVVEAVNSDSDSEFGIPKKTTTPKGKGRGAKKRKASGSENEGDYNPGRKTSKTTSKKPKKT
  SFDQDSDVDIFPSDFPTEPPSLPRTGRARKEVKYFAESDEEEDDVDFAMFN

• Structural information:
  • Protein Domains: (476..59-)
    (/note="Toprim-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00995"-)
  • Interpro: IPR012542  IPR003594  IPR036890  IPR020568  IPR014721   IPR001241  IPR013760  IPR002205  IPR013758  IPR013757  IPR013759  IPR013506  IPR018522  IPR031660  IPR006171  IPR034157  
  • Prosite: PS00177 PS50880
  • CDD: cd00187 cd03365
  • PDB: 3QX3 4G0U 4G0V 4G0W 4J3N 5GWI 5GWJ 5ZAD 5ZEN 5ZQF 5ZRF
  • PDBsum: 3QX3 4G0U 4G0V 4G0W 4J3N 5GWI 5GWJ 5ZAD 5ZEN 5ZQF 5ZRF
  • STRING: ENSP00000396704
• Other Databases: GeneCards:  TOP2B  Malacards:  TOP2B

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000712	resolution of meiotic recombination intermediates	IBA	biological process
GO:0005634	nucleus	IBA	cellular component
GO:0000819	sister chromatid segregation	IBA	biological process
GO:0044774	mitotic DNA integrity checkpoint	IBA	biological process
GO:0003918	DNA topoisomerase type II (double strand cut, ATP-hydrolyzing) activity	IDA	molecular function
GO:0006265	DNA topological change	IDA	biological process
GO:1990904	ribonucleoprotein complex	ISS	cellular component
GO:0003918	DNA topoisomerase type II (double strand cut, ATP-hydrolyzing) activity	IEA	molecular function
GO:0003677	DNA binding	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0006259	DNA metabolic process	IEA	biological process
GO:0006265	DNA topological change	IEA	biological process
GO:0046872	metal ion binding	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0016853	isomerase activity	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0003916	DNA topoisomerase activity	IEA	molecular function
GO:0003677	DNA binding	IEA	molecular function
GO:0000166	nucleotide binding	IEA	molecular function
GO:0003918	DNA topoisomerase type II (double strand cut, ATP-hydrolyzing) activity	IEA	molecular function
GO:0005654	nucleoplasm	TAS	cellular component
GO:0001764	neuron migration	IEA	biological process
GO:0030900	forebrain development	IEA	biological process
GO:0007409	axonogenesis	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0005730	nucleolus	IDA	NOT|cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0000792	heterochromatin	IDA	colocalizes with
GO:0005634	nucleus	IDA	cellular component
GO:0003682	chromatin binding	IDA	molecular function
GO:0005634	nucleus	IDA	cellular component
GO:0008022	protein C-terminus binding	IPI	molecular function
GO:0005080	protein kinase C binding	IPI	molecular function
GO:0019899	enzyme binding	IPI	molecular function
GO:0046982	protein heterodimerization activity	IPI	molecular function
GO:0042826	histone deacetylase binding	IPI	molecular function
GO:0042826	histone deacetylase binding	IPI	molecular function
GO:0042826	histone deacetylase binding	IPI	molecular function
GO:0045870	positive regulation of single stranded viral RNA replication via double stranded DNA intermediate	IMP	biological process
GO:0019035	viral integration complex	IMP	cellular component

KEGG pathways

Pathway id	Pathway name
hsa01524	Platinum drug resistance

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881