• Gene id: 7153

Gene Summary

• Gene Symbol: TOP2A   Gene   UCSC   Ensembl
• Aliases: TOP2, TP2A
• Gene name: DNA topoisomerase II alpha
• Alternate names: DNA topoisomerase 2-alpha, DNA gyrase, DNA topoisomerase (ATP-hydrolyzing), DNA topoisomerase II, 170 kD, DNA topoisomerase II, alpha isozyme, topoisomerase (DNA) II alpha 170kDa,
• Gene location: 17q21.2 (40417949: 40388520)     Exons: 36     NC_000017.11
• Gene summary(Entrez): This gene encodes a DNA topoisomerase, an enzyme that controls and alters the topologic states of DNA during transcription. This nuclear enzyme is involved in processes such as chromosome condensation, chromatid separation, and the relief of torsional str
• OMIM: 126430

Protein Summary

• Protein general information: P11388  
  • Name: DNA topoisomerase 2 alpha (EC 5.99.1.3) (DNA topoisomerase II, alpha isozyme)
  • Length: 1531  
  • Mass: 174,385
• Sequence:

  MEVSPLQPVNENMQVNKIKKNEDAKKRLSVERIYQKKTQLEHILLRPDTYIGSVELVTQQMWVYDEDVGINYREV
  TFVPGLYKIFDEILVNAADNKQRDPKMSCIRVTIDPENNLISIWNNGKGIPVVEHKVEKMYVPALIFGQLLTSSN
  YDDDEKKVTGGRNGYGAKLCNIFSTKFTVETASREYKKMFKQTWMDNMGRAGEMELKPFNGEDYTCITFQPDLSK
  FKMQSLDKDIVALMVRRAYDIAGSTKDVKVFLNGNKLPVKGFRSYVDMYLKDKLDETGNSLKVIHEQVNHRWEVC
  LTMSEKGFQQISFVNSIATSKGGRHVDYVADQIVTKLVDVVKKKNKGGVAVKAHQVKNHMWIFVNALIENPTFDS
  QTKENMTLQPKSFGSTCQLSEKFIKAAIGCGIVESILNWVKFKAQVQLNKKCSAVKHNRIKGIPKLDDANDAGGR
  NSTECTLILTEGDSAKTLAVSGLGVVGRDKYGVFPLRGKILNVREASHKQIMENAEINNIIKIVGLQYKKNYEDE
  DSLKTLRYGKIMIMTDQDQDGSHIKGLLINFIHHNWPSLLRHRFLEEFITPIVKVSKNKQEMAFYSLPEFEEWKS
  STPNHKKWKVKYYKGLGTSTSKEAKEYFADMKRHRIQFKYSGPEDDAAISLAFSKKQIDDRKEWLTNFMEDRRQR
  KLLGLPEDYLYGQTTTYLTYNDFINKELILFSNSDNERSIPSMVDGLKPGQRKVLFTCFKRNDKREVKVAQLAGS
  VAEMSSYHHGEMSLMMTIINLAQNFVGSNNLNLLQPIGQFGTRLHGGKDSASPRYIFTMLSSLARLLFPPKDDHT
  LKFLYDDNQRVEPEWYIPIIPMVLINGAEGIGTGWSCKIPNFDVREIVNNIRRLMDGEEPLPMLPSYKNFKGTIE
  ELAPNQYVISGEVAILNSTTIEISELPVRTWTQTYKEQVLEPMLNGTEKTPPLITDYREYHTDTTVKFVVKMTEE
  KLAEAERVGLHKVFKLQTSLTCNSMVLFDHVGCLKKYDTVLDILRDFFELRLKYYGLRKEWLLGMLGAESAKLNN
  QARFILEKIDGKIIIENKPKKELIKVLIQRGYDSDPVKAWKEAQQKVPDEEENEESDNEKETEKSDSVTDSGPTF
  NYLLDMPLWYLTKEKKDELCRLRNEKEQELDTLKRKSPSDLWKEDLATFIEELEAVEAKEKQDEQVGLPGKGGKA
  KGKKTQMAEVLPSPRGQRVIPRITIEMKAEAEKKNKKKIKNENTEGSPQEDGVELEGLKQRLEKKQKREPGTKTK
  KQTTLAFKPIKKGKKRNPWSDSESDRSSDESNFDVPPRETEPRRAATKTKFTMDLDSDEDFSDFDEKTDDEDFVP
  SDASPPKTKTSPKLSNKELKPQKSVVSDLEADDVKGSVPLSSSPPATHFPDETEITNPVPKKNVTVKKTAAKSQS
  STSTTGAKKRAAPKGTKRDPALNSGVSQKPDPAKTKNRRKRKPSTSDDSDSNFEKIVSKAVTSKKSKGESDDFHM
  DFDSAVAPRAKSVRAKKPIKYLEESDEDDLF

• Structural information:
  • Protein Domains: Toprim. (455-572)
  • Interpro: IPR012542  IPR003594  IPR036890  IPR020568  IPR014721   IPR001241  IPR013760  IPR002205  IPR013758  IPR013759  IPR013506  IPR018522  IPR031660  IPR006171  IPR034157  
  • Prosite: PS00177 PS50880
  • CDD: cd00075 cd03365
  • PDB: 1LWZ 1ZXM 1ZXN 4FM9 4R1F 5GWK
  • PDBsum: 1LWZ 1ZXM 1ZXN 4FM9 4R1F 5GWK
  • DIP: 33887
  • STRING: ENSP00000411532
• Other Databases: GeneCards:  TOP2A  Malacards:  TOP2A

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000287	magnesium ion binding	IDA	molecular function
GO:0000712	resolution of meiotic recombination intermediates	IBA	biological process
GO:0000793	condensed chromosome	IEA	cellular component
GO:0000819	sister chromatid segregation	IBA	biological process
GO:0002244	hematopoietic progenitor cell differentiation	IEA	biological process
GO:0003677	DNA binding	IDA	molecular function
GO:0003677	DNA binding	IDA	molecular function
GO:0003677	DNA binding	IDA	molecular function
GO:0003682	chromatin binding	IDA	molecular function
GO:0003918	DNA topoisomerase type II (ATP-hydrolyzing) activity	IDA	molecular function
GO:0005080	protein kinase C binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0005634	nucleus	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005730	nucleolus	IDA	cellular component
GO:0005730	nucleolus	IDA	cellular component
GO:0006265	DNA topological change	IDA	biological process
GO:0006266	DNA ligation	IDA	biological process
GO:0006268	DNA unwinding involved in DNA replication	IBA	biological process
GO:0006312	mitotic recombination	IBA	biological process
GO:0006974	cellular response to DNA damage stimulus	IDA	biological process
GO:0007059	chromosome segregation	IMP	biological process
GO:0007059	chromosome segregation	IMP	biological process
GO:0007059	chromosome segregation	IMP	biological process
GO:0008022	protein C-terminus binding	IPI	molecular function
GO:0008022	protein C-terminus binding	IPI	molecular function
GO:0008094	DNA-dependent ATPase activity	IDA	molecular function
GO:0008144	drug binding	IDA	molecular function
GO:0008301	DNA binding, bending	IDA	molecular function
GO:0009330	DNA topoisomerase complex (ATP-hydrolyzing)	IDA	cellular component
GO:0016925	protein sumoylation	TAS	biological process
GO:0016925	protein sumoylation	TAS	biological process
GO:0019899	enzyme binding	IPI	molecular function
GO:0019899	enzyme binding	IPI	molecular function
GO:0030263	apoptotic chromosome condensation	IDA	biological process
GO:0040016	embryonic cleavage	IEA	biological process
GO:0042752	regulation of circadian rhythm	ISS	biological process
GO:0042803	protein homodimerization activity	IPI	molecular function
GO:0042826	histone deacetylase binding	IPI	molecular function
GO:0042826	histone deacetylase binding	IPI	molecular function
GO:0043065	positive regulation of apoptotic process	IDA	biological process
GO:0043130	ubiquitin binding	IMP	molecular function
GO:0043234	protein complex	IDA	cellular component
GO:0044774	mitotic DNA integrity checkpoint	IBA	biological process
GO:0044822	poly(A) RNA binding	IDA	molecular function
GO:0045070	positive regulation of viral genome replication	IMP	biological process
GO:0045870	positive regulation of single stranded viral RNA replication via double stranded DNA intermediate	IMP	biological process
GO:0045944	positive regulation of transcription from RNA polymerase II promoter	IEA	biological process
GO:0046982	protein heterodimerization activity	IPI	molecular function
GO:0048511	rhythmic process	IEA	biological process
GO:0005730	nucleolus	IDA	cellular component
GO:0009295	nucleoid	IBA	cellular component
GO:0000228	nuclear chromosome	IDA	cellular component
GO:0005814	centriole	IDA	cellular component
GO:0019035	viral integration complex	NAS	cellular component
GO:0000166	nucleotide binding	IEA	molecular function
GO:0000287	magnesium ion binding	IEA	molecular function
GO:0000287	magnesium ion binding	IDA	molecular function
GO:0000712	resolution of meiotic recombination intermediates	IBA	biological process
GO:0000793	condensed chromosome	IEA	cellular component
GO:0000819	sister chromatid segregation	IBA	biological process
GO:0002244	hematopoietic progenitor cell differentiation	IEA	biological process
GO:0003677	DNA binding	IEA	molecular function
GO:0003677	DNA binding	IEA	molecular function
GO:0003677	DNA binding	IDA	molecular function
GO:0003677	DNA binding	IDA	molecular function
GO:0003677	DNA binding	IDA	molecular function
GO:0003682	chromatin binding	IDA	molecular function
GO:0003916	DNA topoisomerase activity	IEA	molecular function
GO:0003918	DNA topoisomerase type II (ATP-hydrolyzing) activity	IEA	molecular function
GO:0003918	DNA topoisomerase type II (ATP-hydrolyzing) activity	IEA	molecular function
GO:0003918	DNA topoisomerase type II (ATP-hydrolyzing) activity	IEA	molecular function
GO:0003918	DNA topoisomerase type II (ATP-hydrolyzing) activity	IDA	molecular function
GO:0005080	protein kinase C binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005654	nucleoplasm	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005730	nucleolus	IDA	cellular component
GO:0005730	nucleolus	IDA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0006259	DNA metabolic process	IEA	biological process
GO:0006265	DNA topological change	IEA	biological process
GO:0006265	DNA topological change	IEA	biological process
GO:0006265	DNA topological change	IDA	biological process
GO:0006266	DNA ligation	IDA	biological process
GO:0006268	DNA unwinding involved in DNA replication	IBA	biological process
GO:0006312	mitotic recombination	IBA	biological process
GO:0006974	cellular response to DNA damage stimulus	IDA	biological process
GO:0007059	chromosome segregation	IEA	biological process
GO:0007059	chromosome segregation	IMP	biological process
GO:0007059	chromosome segregation	IMP	biological process
GO:0007059	chromosome segregation	IMP	biological process
GO:0008022	protein C-terminus binding	IPI	molecular function
GO:0008022	protein C-terminus binding	IPI	molecular function
GO:0008094	DNA-dependent ATPase activity	IDA	molecular function
GO:0008144	drug binding	IDA	molecular function
GO:0008301	DNA binding, bending	IEA	molecular function
GO:0008301	DNA binding, bending	IDA	molecular function
GO:0009330	DNA topoisomerase complex (ATP-hydrolyzing)	IDA	cellular component
GO:0016853	isomerase activity	IEA	molecular function
GO:0016925	protein sumoylation	TAS	biological process
GO:0016925	protein sumoylation	TAS	biological process
GO:0019899	enzyme binding	IPI	molecular function
GO:0019899	enzyme binding	IPI	molecular function
GO:0030261	chromosome condensation	IEA	biological process
GO:0030263	apoptotic chromosome condensation	IDA	biological process
GO:0040016	embryonic cleavage	IEA	biological process
GO:0042752	regulation of circadian rhythm	IEA	biological process
GO:0042752	regulation of circadian rhythm	ISS	biological process
GO:0042803	protein homodimerization activity	IPI	molecular function
GO:0042826	histone deacetylase binding	IPI	molecular function
GO:0042826	histone deacetylase binding	IPI	molecular function
GO:0043065	positive regulation of apoptotic process	IDA	biological process
GO:0043130	ubiquitin binding	IMP	molecular function
GO:0043234	protein complex	IDA	cellular component
GO:0044774	mitotic DNA integrity checkpoint	IBA	biological process
GO:0044822	poly(A) RNA binding	IDA	molecular function
GO:0045070	positive regulation of viral genome replication	IMP	biological process
GO:0045870	positive regulation of single stranded viral RNA replication via double stranded DNA intermediate	IMP	biological process
GO:0045944	positive regulation of transcription from RNA polymerase II promoter	IEA	biological process
GO:0046872	metal ion binding	IEA	molecular function
GO:0046982	protein heterodimerization activity	IPI	molecular function
GO:0048511	rhythmic process	IEA	biological process
GO:0005730	nucleolus	IDA	cellular component
GO:0009295	nucleoid	IBA	cellular component
GO:0000228	nuclear chromosome	IDA	cellular component
GO:0005814	centriole	IDA	cellular component
GO:0019035	viral integration complex	NAS	cellular component
GO:0000287	magnesium ion binding	IDA	molecular function
GO:0000712	resolution of meiotic recombination intermediates	IBA	biological process
GO:0000819	sister chromatid segregation	IBA	biological process
GO:0003677	DNA binding	IDA	molecular function
GO:0003677	DNA binding	IDA	molecular function
GO:0003677	DNA binding	IDA	molecular function
GO:0003682	chromatin binding	IDA	molecular function
GO:0003918	DNA topoisomerase type II (ATP-hydrolyzing) activity	IDA	molecular function
GO:0005080	protein kinase C binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005730	nucleolus	IDA	cellular component
GO:0005730	nucleolus	IDA	cellular component
GO:0006265	DNA topological change	IDA	biological process
GO:0006266	DNA ligation	IDA	biological process
GO:0006268	DNA unwinding involved in DNA replication	IBA	biological process
GO:0006312	mitotic recombination	IBA	biological process
GO:0006974	cellular response to DNA damage stimulus	IDA	biological process
GO:0007059	chromosome segregation	IMP	biological process
GO:0007059	chromosome segregation	IMP	biological process
GO:0007059	chromosome segregation	IMP	biological process
GO:0008022	protein C-terminus binding	IPI	molecular function
GO:0008022	protein C-terminus binding	IPI	molecular function
GO:0008094	DNA-dependent ATPase activity	IDA	molecular function
GO:0008144	drug binding	IDA	molecular function
GO:0008301	DNA binding, bending	IDA	molecular function
GO:0009330	DNA topoisomerase complex (ATP-hydrolyzing)	IDA	cellular component
GO:0016925	protein sumoylation	TAS	biological process
GO:0016925	protein sumoylation	TAS	biological process
GO:0019899	enzyme binding	IPI	molecular function
GO:0019899	enzyme binding	IPI	molecular function
GO:0030263	apoptotic chromosome condensation	IDA	biological process
GO:0042752	regulation of circadian rhythm	ISS	biological process
GO:0042803	protein homodimerization activity	IPI	molecular function
GO:0042826	histone deacetylase binding	IPI	molecular function
GO:0042826	histone deacetylase binding	IPI	molecular function
GO:0043065	positive regulation of apoptotic process	IDA	biological process
GO:0043130	ubiquitin binding	IMP	molecular function
GO:0043234	protein complex	IDA	cellular component
GO:0044774	mitotic DNA integrity checkpoint	IBA	biological process
GO:0044822	poly(A) RNA binding	IDA	molecular function
GO:0045070	positive regulation of viral genome replication	IMP	biological process
GO:0045870	positive regulation of single stranded viral RNA replication via double stranded DNA intermediate	IMP	biological process
GO:0046982	protein heterodimerization activity	IPI	molecular function
GO:0005730	nucleolus	IDA	cellular component
GO:0009295	nucleoid	IBA	cellular component
GO:0000228	nuclear chromosome	IDA	cellular component
GO:0005814	centriole	IDA	cellular component
GO:0019035	viral integration complex	NAS	cellular component

KEGG pathways

Pathway id	Pathway name
hsa01524	Platinum drug resistance

Diseases

Associated diseases	References
Cancer	GAD: 16139951
Cancer (leukemia)	GAD: 19074885
Cancer (breast)	GAD: 19620488
Cancer (lymphoma)	GAD: 16139951
Poor sperm motility	MIK: 25118297
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
25118297	Poor sperm motility				Male infertility	DRP1 RanGAP1 Topoisomerase Ii? SUMO1
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R