• Gene id: 7142

Gene Summary

• Gene Symbol: TNP2   Gene   UCSC   Ensembl
• Aliases: TP2
• Gene name: transition protein 2
• Alternate names: nuclear transition protein 2, TP-2, transition protein 2 (during histone to protamine replacement),
• Gene location: 16p13.13 (143435511: 143277930)     Exons: 15     NC_000005.10
• OMIM: 190232

Protein Summary

• Protein general information: Q05952  
  • Name: Nuclear transition protein 2 (TP 2) (TP2)
  • Length: 138  
  • Mass: 15,641
• Sequence:

  MDTQTHSLPITHTQLHSNSQPQSRTCTRHCQTFSQSCRQSHRGSRSQSSSQSPASHRNPTGAHSSSGHQSQSPNT
  SPPPKRHKKTMNSHHSPMRPTILHCRCPKNRKNLEGKLKKKKMAKRIQQVYKTKTRSSGWKSN

• Structural information:
  • Interpro: IPR000678  
  • Prosite: PS00970 PS00971
  • STRING: ENSP00000325738
• Other Databases: GeneCards:  TNP2  Malacards:  TNP2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000786	nucleosome	IEA	cellular component
GO:0001673	male germ cell nucleus	IBA	cellular component
GO:0003677	DNA binding	IEA	molecular function
GO:0005730	nucleolus	IEA	cellular component
GO:0007275	multicellular organism development	IEA	biological process
GO:0007283	spermatogenesis	IBA	biological process
GO:0007340	acrosome reaction	IBA	biological process
GO:0007341	penetration of zona pellucida	IBA	biological process
GO:0008270	zinc ion binding	IBA	molecular function
GO:0030154	cell differentiation	IEA	biological process
GO:0000786	nucleosome	IEA	cellular component
GO:0000786	nucleosome	IEA	cellular component
GO:0001673	male germ cell nucleus	IBA	cellular component
GO:0003677	DNA binding	IEA	molecular function
GO:0003677	DNA binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005694	chromosome	IEA	cellular component
GO:0005694	chromosome	IEA	cellular component
GO:0005730	nucleolus	IEA	cellular component
GO:0007275	multicellular organism development	IEA	biological process
GO:0007283	spermatogenesis	IEA	biological process
GO:0007283	spermatogenesis	IBA	biological process
GO:0007283	spermatogenesis	IEA	biological process
GO:0007340	acrosome reaction	IBA	biological process
GO:0007341	penetration of zona pellucida	IBA	biological process
GO:0008270	zinc ion binding	IEA	molecular function
GO:0008270	zinc ion binding	IBA	molecular function
GO:0030154	cell differentiation	IEA	biological process
GO:0046872	metal ion binding	IEA	molecular function
GO:0001673	male germ cell nucleus	IBA	cellular component
GO:0007283	spermatogenesis	IBA	biological process
GO:0007340	acrosome reaction	IBA	biological process
GO:0007341	penetration of zona pellucida	IBA	biological process
GO:0008270	zinc ion binding	IBA	molecular function

Diseases

Associated diseases	References
Diabetes	GAD: 18978792
Azoospermia	GAD: 20378615
Asthenozoospermia	MIK: 17852044
Teratozoospermia	MIK: 25536093
Male factor infertility	MIK: 16989827
Associated with spermatogenesis and epigenetic regulation	MIK: 21674046
Asthenozoospermia	MIK: 17852044
Causes abnormal head morphogenesis	MIK: 16967499
Reduced sperm motility	MIK: 16967499
Male infertility	MIK: 16291974
Teratozoospermia	MIK: 11385107
Male infertility	MIK: 25536093
Spermatogenic defects	MIK: 31037746

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
16989827	Male infertility			288 (96 fertile men, 96 severely infertile men, and 96 infertility patients)	Male infertility
17852044	Asthenozoospermia			170 (70 normozoospermia, 100 asthenozoospermia)	Male infertility	HILS1 TNP1 and TNP2
25536093	Male infertility, teratozoospermic			138 (72 teratozoospermia, 66 normozoospermic)	Male infertility	PRM1 PRM2 and TNP2
16291974	Male infertility			818 (282 sterile male patients, 270 (TNP1), 266 (TNP2) proven-fertile male volunteers)	Male infertility	TNP1 TNP2
16967499	Causes abnormal head morphogenesis, reduced sperm motility and male infertility				Male infertility
11385107	Male infertility, sperm head abnormalities and reduced sperm motility, teratozoospermia				Male infertility
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Associated with spermatogenesis and epigenetic regulation			18	Male infertility	GSE26881
31037746	Spermatogenic defects			28 men with azoospermia	Male infertility	Microarray