• Gene id: 7140

Gene Summary

• Gene Symbol: TNNT3   Gene   UCSC   Ensembl
• Aliases: DA2B2, TNTF, beta-TnTF
• Gene name: troponin T3, fast skeletal type
• Alternate names: troponin T, fast skeletal muscle, troponin T type 3 (skeletal, fast),
• Gene location: 11p15.5 (1919550: 1938703)     Exons: 22     NC_000011.10
• Gene summary(Entrez): The binding of Ca(2+) to the trimeric troponin complex initiates the process of muscle contraction. Increased Ca(2+) concentrations produce a conformational change in the troponin complex that is transmitted to tropomyosin dimers situated along actin fila
• OMIM: 601895

Protein Summary

• Protein general information: P45378  
  • Name: Troponin T, fast skeletal muscle (TnTf) (Beta TnTF) (Fast skeletal muscle troponin T) (fTnT)
  • Length: 269  
  • Mass: 31825
  • Tissue specificity: In fetal and adult fast skeletal muscles, with a higher level expression in fetal than in adult muscle.
• Sequence:

  MSDEEVEQVEEQYEEEEEAQEEAAEVHEEVHEPEEVQEDTAEEDAEEEKPRPKLTAPKIPEGEKVDFDDIQKKRQ
  NKDLMELQALIDSHFEARKKEEEELVALKERIEKRRAERAEQQRIRAEKERERQNRLAEEKARREEEDAKRRAED
  DLKKKKALSSMGANYSSYLAKADQKRGKKQTAREMKKKILAERRKPLNIDHLGEDKLRDKAKELWETLHQLEIDK
  FEFGEKLKRQKYDITTLRSRIDQAQKHSKKAGTPAKGKVGGRWK

• Structural information:
  • Interpro: IPR027707  IPR027708  IPR001978  IPR038077  
  • STRING: ENSP00000278317
• Other Databases: GeneCards:  TNNT3  Malacards:  TNNT3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005509	calcium ion binding	IBA	molecular function
GO:0005523	tropomyosin binding	IBA	contributes to
GO:0005861	troponin complex	IBA	cellular component
GO:0030899	calcium-dependent ATPase activity	IBA	contributes to
GO:0003009	skeletal muscle contraction	IBA	biological process
GO:0006936	muscle contraction	IBA	biological process
GO:0030172	troponin C binding	IBA	molecular function
GO:0031013	troponin I binding	IBA	molecular function
GO:0045214	sarcomere organization	IBA	biological process
GO:0060048	cardiac muscle contraction	IBA	biological process
GO:0005861	troponin complex	IEA	cellular component
GO:0006937	regulation of muscle contraction	IEA	biological process
GO:0006942	regulation of striated muscle contraction	IEA	biological process
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0030049	muscle filament sliding	TAS	biological process
GO:0030899	calcium-dependent ATPase activity	IDA	contributes to
GO:0005523	tropomyosin binding	IDA	contributes to
GO:0003779	actin binding	IDA	contributes to
GO:0048306	calcium-dependent protein binding	IDA	molecular function
GO:0006942	regulation of striated muscle contraction	IDA	biological process
GO:0003009	skeletal muscle contraction	IDA	biological process
GO:0043462	regulation of ATPase activity	IDA	biological process
GO:0030899	calcium-dependent ATPase activity	IDA	contributes to
GO:0005861	troponin complex	IDA	cellular component
GO:0005861	troponin complex	IDA	cellular component
GO:0005861	troponin complex	IDA	cellular component
GO:0005523	tropomyosin binding	IMP	molecular function
GO:0031013	troponin I binding	IPI	molecular function
GO:0030172	troponin C binding	IPI	molecular function
GO:0031013	troponin I binding	IPI	molecular function
GO:0031013	troponin I binding	IPI	molecular function
GO:0030172	troponin C binding	IPI	molecular function

Diseases

Associated diseases	References
Distal arthrogryposis	KEGG:H00811
Distal arthrogryposis	KEGG:H00811
Distal arthrogryposis type 2B	PMID:12865991
Cryptorchidism	MIK: 28606200
Spermatogenic defects	MIK: 31037746

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
31037746	Spermatogenic defects			28 men with azoospermia	Male infertility	Microarray