• Gene id: 7133

Gene Summary

• Gene Symbol: TNFRSF1B   Gene   UCSC   Ensembl
• Aliases: CD120b, TBPII, TNF-R-II, TNF-R75, TNFBR, TNFR1B, TNFR2, TNFR80, p75, p75TNFR
• Gene name: TNF receptor superfamily member 1B
• Alternate names: tumor necrosis factor receptor superfamily member 1B, TNF-R2, TNF-RII, p75 TNF receptor, p80 TNF-alpha receptor, soluble TNFR1B variant 1, tumor necrosis factor beta receptor, tumor necrosis factor binding protein 2, tumor necrosis factor receptor 2, tumo,
• Gene location: 1p36.22 (12166947: 12209221)     Exons: 11     NC_000001.11
• Gene summary(Entrez): The protein encoded by this gene is a member of the TNF-receptor superfamily. This protein and TNF-receptor 1 form a heterocomplex that mediates the recruitment of two anti-apoptotic proteins, c-IAP1 and c-IAP2, which possess E3 ubiquitin ligase activity.
• OMIM: 191191

Protein Summary

• Protein general information: P20333  
  • Name: Tumor necrosis factor receptor superfamily member 1B (Tumor necrosis factor receptor 2) (TNF R2) (Tumor necrosis factor receptor type II) (TNF RII) (TNFR II) (p75) (p80 TNF alpha receptor) (CD antigen CD120b) (Etanercept) [Cleaved into: Tumor necrosis fac
  • Length: 461  
  • Mass: 48,291
  • Tissue specificity: Expressed in brain, lung, spleen and skeletal muscle. Lower levels detected in heart and kidney. Not detected in the pancreas. In non-lymphoid tissues, in the absence of inflammation, the major source of constitutive expression is the
• Sequence:

  MAPVAVWAALAVGLELWAAAHALPAQVAFTPYAPEPGSTCRLREYYDQTAQMCCSKCSPGQHAKVFCTKTSDTVC
  DSCEDSTYTQLWNWVPECLSCGSRCSSDQVETQACTREQNRICTCRPGWYCALSKQEGCRLCAPLRKCRPGFGVA
  RPGTETSDVVCKPCAPGTFSNTTSSTDICRPHQICNVVAIPGNASMDAVCTSTSPTRSMAPGAVHLPQPVSTRSQ
  HTQPTPEPSTAPSTSFLLPMGPSPPAEGSTGDFALPVGLIVGVTALGLLIIGVVNCVIMTQVKKKPLCLQREAKV
  PHLPADKARGTQGPEQQHLLITAPSSSSSSLESSASALDRRAPTRNQPQAPGVEASGAGEARASTGSSDSSPGGH
  GTQVNVTCIVNVCSSSDHSSQCSSQASSTMGDTDSSPSESPKDEQVPFSKEECAFRSQLETPETLLGSTEEKPLP
  LGVPDAGMKPS

• Structural information:
  • Interpro: IPR001368  IPR020411  IPR033996  
  • Prosite: PS00652 PS50050
  • CDD: cd10577
  • PDB: 1CA9 3ALQ
  • PDBsum: 1CA9 3ALQ
  • DIP: 78
  • STRING: ENSP00000365435
• Other Databases: GeneCards:  TNFRSF1B  Malacards:  TNFRSF1B

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005031	tumor necrosis factor-activated receptor activity	IEA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005887	integral component of plasma membrane	IBA	cellular component
GO:0006954	inflammatory response	IBA	biological process
GO:0006955	immune response	IBA	biological process
GO:0007275	multicellular organism development	IBA	biological process
GO:0007568	aging	IEA	biological process
GO:0008630	intrinsic apoptotic signaling pathway in response to DNA damage	IEA	biological process
GO:0031625	ubiquitin protein ligase binding	IPI	molecular function
GO:0033209	tumor necrosis factor-mediated signaling pathway	TAS	biological process
GO:0042127	regulation of cell proliferation	IBA	biological process
GO:0042981	regulation of apoptotic process	IBA	biological process
GO:0043025	neuronal cell body	IEA	cellular component
GO:0043196	varicosity	IEA	cellular component
GO:0043410	positive regulation of MAPK cascade	IBA	biological process
GO:0045121	membrane raft	IDA	cellular component
GO:0048471	perinuclear region of cytoplasm	IEA	cellular component
GO:0050728	negative regulation of inflammatory response	IEA	biological process
GO:0050779	RNA destabilization	IEA	biological process
GO:0051044	positive regulation of membrane protein ectodomain proteolysis	IMP	biological process
GO:0071222	cellular response to lipopolysaccharide	IMP	biological process
GO:0071363	cellular response to growth factor stimulus	IEA	biological process
GO:0097190	apoptotic signaling pathway	IBA	biological process
GO:0097191	extrinsic apoptotic signaling pathway	IEA	biological process
GO:0005031	tumor necrosis factor-activated receptor activity	IEA	molecular function
GO:0005031	tumor necrosis factor-activated receptor activity	IEA	molecular function
GO:0005031	tumor necrosis factor-activated receptor activity	TAS	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0005576	extracellular region	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005887	integral component of plasma membrane	IBA	cellular component
GO:0006915	apoptotic process	IEA	biological process
GO:0006954	inflammatory response	IEA	biological process
GO:0006954	inflammatory response	IBA	biological process
GO:0006955	immune response	IEA	biological process
GO:0006955	immune response	IBA	biological process
GO:0007166	cell surface receptor signaling pathway	IEA	biological process
GO:0007275	multicellular organism development	IBA	biological process
GO:0007568	aging	IEA	biological process
GO:0008630	intrinsic apoptotic signaling pathway in response to DNA damage	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0030424	axon	IEA	cellular component
GO:0031625	ubiquitin protein ligase binding	IPI	molecular function
GO:0032496	response to lipopolysaccharide	IEA	biological process
GO:0033209	tumor necrosis factor-mediated signaling pathway	IEA	biological process
GO:0033209	tumor necrosis factor-mediated signaling pathway	TAS	biological process
GO:0042127	regulation of cell proliferation	IBA	biological process
GO:0042981	regulation of apoptotic process	IBA	biological process
GO:0043025	neuronal cell body	IEA	cellular component
GO:0043196	varicosity	IEA	cellular component
GO:0043410	positive regulation of MAPK cascade	IBA	biological process
GO:0045121	membrane raft	IEA	cellular component
GO:0045121	membrane raft	IDA	cellular component
GO:0048471	perinuclear region of cytoplasm	IEA	cellular component
GO:0050728	negative regulation of inflammatory response	IEA	biological process
GO:0050779	RNA destabilization	IEA	biological process
GO:0051044	positive regulation of membrane protein ectodomain proteolysis	IMP	biological process
GO:0071222	cellular response to lipopolysaccharide	IMP	biological process
GO:0071363	cellular response to growth factor stimulus	IEA	biological process
GO:0097190	apoptotic signaling pathway	IBA	biological process
GO:0097191	extrinsic apoptotic signaling pathway	IEA	biological process
GO:0005031	tumor necrosis factor-activated receptor activity	TAS	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005887	integral component of plasma membrane	IBA	cellular component
GO:0006954	inflammatory response	IBA	biological process
GO:0006955	immune response	IBA	biological process
GO:0007275	multicellular organism development	IBA	biological process
GO:0031625	ubiquitin protein ligase binding	IPI	molecular function
GO:0033209	tumor necrosis factor-mediated signaling pathway	TAS	biological process
GO:0042127	regulation of cell proliferation	IBA	biological process
GO:0042981	regulation of apoptotic process	IBA	biological process
GO:0043410	positive regulation of MAPK cascade	IBA	biological process
GO:0045121	membrane raft	IDA	cellular component
GO:0051044	positive regulation of membrane protein ectodomain proteolysis	IMP	biological process
GO:0071222	cellular response to lipopolysaccharide	IMP	biological process
GO:0097190	apoptotic signaling pathway	IBA	biological process

KEGG pathways

Pathway id	Pathway name
hsa04668	TNF signaling pathway
hsa04060	Cytokine-cytokine receptor interaction
hsa04061	Viral protein interaction with cytokine and cytokine receptor
hsa04920	Adipocytokine signaling pathway
hsa05014	Amyotrophic lateral sclerosis
hsa05170	Human immunodeficiency virus 1 infection

Diseases

Associated diseases	References
Cancer	GAD: 18206417
Cancer (breast)	GAD: 15863392
Cancer (leukemia)	GAD: 19074885
Cancer (lung)	GAD: 19773451
Cancer (lymphoma)	GAD: 15146559
Cancer (myeloma)	GAD: 20568250
Cancer (ovarian)	GAD: 20628624
Cancer (Squamous cell)	GAD: 20646319
Atherosclerosis	GAD: 17346438
Cardiovascular disease	GAD: 11737221
Hypertension	GAD: 16003175
Myocardial Infarction	GAD: 17634906
Uveitis	GAD: 15851552
Anemia	GAD: 16142859
Aggressive periodontitis	GAD: 19892918
Arthritis	GAD: 11212177
Autoimmune diseases	GAD: 11169260
Behcet's disease	GAD: 12770792
Behcet's disease	GAD: 12770792
Inflammatory bowel disease	GAD: 19421420
Ulcerative colitis	GAD: 19174780
Rheumatoid arthritis	GAD: 12528135
Multiple sclerosis	GAD: 14651520
Periodontitis	GAD: 15142217
Psoriatic arthritis	GAD: 17530646
Systemic lupus erythematosus (SLE)	GAD: 15674653
Systemic lupus erythematosus (SLE)	GAD: 11196716
Crohn's disease	GAD: 11196680
Hypercholesterolemia	GAD: 20602615
Obesity	GAD: 10841005
Diabetes	GAD: 10841005
Bone diseases	GAD: 12217957
Osteoarthritis	GAD: 16282562
Osteoporosis	GAD: 19442614
Rheumatic diseases	GAD: 17763205
Alzheimer's disease	GAD: 15091317
Schizophrenia	GAD: 11126399
Chronic renal failure	GAD: 21085059
Chorioamnionitis	GAD: 20452482
Congenital adrenal hyperplasia	GAD: 19039234
Preterm birth risk	GAD: 16731080
Polycystic ovary syndrome (PCOS)	INFBASE: 12161545
Impaired human spermatogenesis	MIK: 19527232
Male factor infertility	MIK: 19527232
Endometriosis	INFBASE: 11006322
Chronic obstructive pulmonary disease (COPD)	GAD: 12661999
Pulmonary fibrosis	GAD: 11371414
Connective tissue diseases	GAD: 19527514
Myelopathy	GAD: 11163081
Spermatogenic defects	MIK: 19527232
Male infertility	MIK: 19527232
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21350240	Infertility	TNF? -857C?T, TNFR1 36A?G, and TNFR2 676T?G polymorphisms		290 (170 normozoospermic, 120 oligospermic )	Male infertility	TNF? TNFR2
19527232	Male infertility			10 patients obtained from patients who had undergone orchidec-tomy resulting from prostatic cancer treatment	Male infertility	IL-6 IL-10  TNF-alpha TNFR1 and TNFR2
19527232	Impaired human spermatogenesis			39 (10 controls, 29 azoospermic patients (9 Sertoli cell only syndrome, 7 undefined maturation arrest, 4 maturation arrest at a spermatocyte stage, 3 maturation arrest at a spermatid stage and OA, 6 obstructive azospermia ) )	Male infertility	IL-6 IL-10 TNF-alpha TNFR1 and TNFR2
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)