• Gene id: 7132

Gene Summary

• Gene Symbol: TNFRSF1A   Gene   UCSC   Ensembl
• Aliases: CD120a, FPF, TBP1, TNF-R, TNF-R-I, TNF-R55, TNFAR, TNFR1, TNFR55, TNFR60, p55, p55-R, p60
• Gene name: TNF receptor superfamily member 1A
• Alternate names: tumor necrosis factor receptor superfamily member 1A, TNF-R1, TNF-RI, TNFR-I, tumor necrosis factor binding protein 1, tumor necrosis factor receptor 1A isoform beta, tumor necrosis factor receptor type 1, tumor necrosis factor-alpha receptor,
• Gene location: 12p13.31 (6342116: 6328756)     Exons: 11     NC_000012.12
• Gene summary(Entrez): This gene encodes a member of the TNF receptor superfamily of proteins. The encoded receptor is found in membrane-bound and soluble forms that interact with membrane-bound and soluble forms, respectively, of its ligand, tumor necrosis factor alpha. Bindin
• OMIM: 191190

Protein Summary

• Protein general information: P19438  
  • Name: Tumor necrosis factor receptor superfamily member 1A (Tumor necrosis factor receptor 1) (TNF R1) (Tumor necrosis factor receptor type I) (TNF RI) (TNFR I) (p55) (p60) (CD antigen CD120a) [Cleaved into: Tumor necrosis factor receptor superfamily member 1A,
  • Length: 455  
  • Mass: 50,495
  • Tissue specificity: Testis-specific. Over-expressed in carcinomas. {ECO
• Sequence:

  MGLSTVPDLLLPLVLLELLVGIYPSGVIGLVPHLGDREKRDSVCPQGKYIHPQNNSICCTKCHKGTYLYNDCPGP
  GQDTDCRECESGSFTASENHLRHCLSCSKCRKEMGQVEISSCTVDRDTVCGCRKNQYRHYWSENLFQCFNCSLCL
  NGTVHLSCQEKQNTVCTCHAGFFLRENECVSCSNCKKSLECTKLCLPQIENVKGTEDSGTTVLLPLVIFFGLCLL
  SLLFIGLMYRYQRWKSKLYSIVCGKSTPEKEGELEGTTTKPLAPNPSFSPTPGFTPTLGFSPVPSSTFTSSSTYT
  PGDCPNFAAPRREVAPPYQGADPILATALASDPIPNPLQKWEDSAHKPQSLDTDDPATLYAVVENVPPLRWKEFV
  RRLGLSDHEIDRLELQNGRCLREAQYSMLATWRRRTPRREATLELLGRVLRDMDLLGCLEDIEEALCGPAALPPA
  PSLLR

• Structural information:
  • Protein Domains: Death. (356-441)
  • Interpro: IPR011029  IPR000488  IPR001368  IPR020419  IPR033994   IPR033993  
  • Prosite: PS50017 PS00652 PS50050
  • CDD: cd08313 cd10576
  • PDB: 1EXT 1FT4 1ICH 1NCF 1TNR
  • PDBsum: 1EXT 1FT4 1ICH 1NCF 1TNR
  • DIP: 407
  • STRING: ENSP00000162749
• Other Databases: GeneCards:  TNFRSF1A  Malacards:  TNFRSF1A

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000139	Golgi membrane	IDA	cellular component
GO:0005031	tumor necrosis factor-activated receptor activity	TAS	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005576	extracellular region	NAS	cellular component
GO:0005615	extracellular space	IDA	cellular component
GO:0005739	mitochondrion	IBA	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005887	integral component of plasma membrane	TAS	cellular component
GO:0006693	prostaglandin metabolic process	IEA	biological process
GO:0006954	inflammatory response	ISS	biological process
GO:0006955	immune response	IBA	biological process
GO:0007249	I-kappaB kinase/NF-kappaB signaling	TAS	biological process
GO:0008625	extrinsic apoptotic signaling pathway via death domain receptors	TAS	biological process
GO:0008630	intrinsic apoptotic signaling pathway in response to DNA damage	IEA	biological process
GO:0009986	cell surface	IEA	cellular component
GO:0010803	regulation of tumor necrosis factor-mediated signaling pathway	TAS	biological process
GO:0016032	viral process	IEA	biological process
GO:0019221	cytokine-mediated signaling pathway	ISS	biological process
GO:0032496	response to lipopolysaccharide	IBA	biological process
GO:0033209	tumor necrosis factor-mediated signaling pathway	IMP	biological process
GO:0033209	tumor necrosis factor-mediated signaling pathway	TAS	biological process
GO:0033209	tumor necrosis factor-mediated signaling pathway	TAS	biological process
GO:0042127	regulation of cell proliferation	IBA	biological process
GO:0042511	positive regulation of tyrosine phosphorylation of Stat1 protein	IMP	biological process
GO:0042742	defense response to bacterium	IEA	biological process
GO:0042981	regulation of apoptotic process	IBA	biological process
GO:0043120	tumor necrosis factor binding	IBA	molecular function
GO:0043123	positive regulation of I-kappaB kinase/NF-kappaB signaling	IEP	biological process
GO:0043235	receptor complex	IDA	cellular component
GO:0045121	membrane raft	IDA	cellular component
GO:0045944	positive regulation of transcription from RNA polymerase II promoter	ISS	biological process
GO:0045944	positive regulation of transcription from RNA polymerase II promoter	IMP	biological process
GO:0050728	negative regulation of inflammatory response	IMP	biological process
GO:0050729	positive regulation of inflammatory response	ISS	biological process
GO:0071260	cellular response to mechanical stimulus	IEP	biological process
GO:0071550	death-inducing signaling complex assembly	TAS	biological process
GO:0090002	establishment of protein localization to plasma membrane	IMP	biological process
GO:1903140	regulation of establishment of endothelial barrier	IMP	biological process
GO:2000304	positive regulation of ceramide biosynthetic process	TAS	biological process
GO:0000139	Golgi membrane	IEA	cellular component
GO:0000139	Golgi membrane	IDA	cellular component
GO:0005031	tumor necrosis factor-activated receptor activity	IEA	molecular function
GO:0005031	tumor necrosis factor-activated receptor activity	IEA	molecular function
GO:0005031	tumor necrosis factor-activated receptor activity	TAS	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0005576	extracellular region	IEA	cellular component
GO:0005576	extracellular region	NAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005615	extracellular space	IDA	cellular component
GO:0005739	mitochondrion	IBA	cellular component
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005887	integral component of plasma membrane	TAS	cellular component
GO:0006693	prostaglandin metabolic process	IEA	biological process
GO:0006915	apoptotic process	IEA	biological process
GO:0006952	defense response	IEA	biological process
GO:0006954	inflammatory response	IEA	biological process
GO:0006954	inflammatory response	IEA	biological process
GO:0006954	inflammatory response	ISS	biological process
GO:0006955	immune response	IBA	biological process
GO:0007165	signal transduction	IEA	biological process
GO:0007166	cell surface receptor signaling pathway	IEA	biological process
GO:0007249	I-kappaB kinase/NF-kappaB signaling	TAS	biological process
GO:0008625	extrinsic apoptotic signaling pathway via death domain receptors	TAS	biological process
GO:0008630	intrinsic apoptotic signaling pathway in response to DNA damage	IEA	biological process
GO:0009986	cell surface	IEA	cellular component
GO:0010803	regulation of tumor necrosis factor-mediated signaling pathway	TAS	biological process
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016032	viral process	IEA	biological process
GO:0019221	cytokine-mediated signaling pathway	IEA	biological process
GO:0019221	cytokine-mediated signaling pathway	ISS	biological process
GO:0032496	response to lipopolysaccharide	IBA	biological process
GO:0033209	tumor necrosis factor-mediated signaling pathway	IEA	biological process
GO:0033209	tumor necrosis factor-mediated signaling pathway	IMP	biological process
GO:0033209	tumor necrosis factor-mediated signaling pathway	TAS	biological process
GO:0033209	tumor necrosis factor-mediated signaling pathway	TAS	biological process
GO:0042127	regulation of cell proliferation	IBA	biological process
GO:0042511	positive regulation of tyrosine phosphorylation of Stat1 protein	IMP	biological process
GO:0042742	defense response to bacterium	IEA	biological process
GO:0042981	regulation of apoptotic process	IBA	biological process
GO:0043120	tumor necrosis factor binding	IBA	molecular function
GO:0043123	positive regulation of I-kappaB kinase/NF-kappaB signaling	IEP	biological process
GO:0043235	receptor complex	IDA	cellular component
GO:0045121	membrane raft	IEA	cellular component
GO:0045121	membrane raft	IDA	cellular component
GO:0045944	positive regulation of transcription from RNA polymerase II promoter	IEA	biological process
GO:0045944	positive regulation of transcription from RNA polymerase II promoter	ISS	biological process
GO:0045944	positive regulation of transcription from RNA polymerase II promoter	IMP	biological process
GO:0050728	negative regulation of inflammatory response	IMP	biological process
GO:0050729	positive regulation of inflammatory response	IEA	biological process
GO:0050729	positive regulation of inflammatory response	ISS	biological process
GO:0071260	cellular response to mechanical stimulus	IEP	biological process
GO:0071550	death-inducing signaling complex assembly	TAS	biological process
GO:0090002	establishment of protein localization to plasma membrane	IMP	biological process
GO:1903140	regulation of establishment of endothelial barrier	IMP	biological process
GO:2000304	positive regulation of ceramide biosynthetic process	TAS	biological process
GO:0000139	Golgi membrane	IDA	cellular component
GO:0005031	tumor necrosis factor-activated receptor activity	TAS	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005576	extracellular region	NAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005615	extracellular space	IDA	cellular component
GO:0005739	mitochondrion	IBA	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005887	integral component of plasma membrane	TAS	cellular component
GO:0006954	inflammatory response	ISS	biological process
GO:0006955	immune response	IBA	biological process
GO:0007249	I-kappaB kinase/NF-kappaB signaling	TAS	biological process
GO:0008625	extrinsic apoptotic signaling pathway via death domain receptors	TAS	biological process
GO:0010803	regulation of tumor necrosis factor-mediated signaling pathway	TAS	biological process
GO:0019221	cytokine-mediated signaling pathway	ISS	biological process
GO:0032496	response to lipopolysaccharide	IBA	biological process
GO:0033209	tumor necrosis factor-mediated signaling pathway	IMP	biological process
GO:0033209	tumor necrosis factor-mediated signaling pathway	TAS	biological process
GO:0033209	tumor necrosis factor-mediated signaling pathway	TAS	biological process
GO:0042127	regulation of cell proliferation	IBA	biological process
GO:0042511	positive regulation of tyrosine phosphorylation of Stat1 protein	IMP	biological process
GO:0042981	regulation of apoptotic process	IBA	biological process
GO:0043120	tumor necrosis factor binding	IBA	molecular function
GO:0043123	positive regulation of I-kappaB kinase/NF-kappaB signaling	IEP	biological process
GO:0043235	receptor complex	IDA	cellular component
GO:0045121	membrane raft	IDA	cellular component
GO:0045944	positive regulation of transcription from RNA polymerase II promoter	ISS	biological process
GO:0045944	positive regulation of transcription from RNA polymerase II promoter	IMP	biological process
GO:0050728	negative regulation of inflammatory response	IMP	biological process
GO:0050729	positive regulation of inflammatory response	ISS	biological process
GO:0071260	cellular response to mechanical stimulus	IEP	biological process
GO:0071550	death-inducing signaling complex assembly	TAS	biological process
GO:0090002	establishment of protein localization to plasma membrane	IMP	biological process
GO:1903140	regulation of establishment of endothelial barrier	IMP	biological process
GO:2000304	positive regulation of ceramide biosynthetic process	TAS	biological process

KEGG pathways

Pathway id	Pathway name
hsa04064	NF-kappa B signaling pathway
hsa04668	TNF signaling pathway
hsa04071	Sphingolipid signaling pathway
hsa04150	mTOR signaling pathway
hsa04060	Cytokine-cytokine receptor interaction
hsa04061	Viral protein interaction with cytokine and cytokine receptor
hsa04210	Apoptosis
hsa04215	Apoptosis - multiple species
hsa04217	Necroptosis
hsa04920	Adipocytokine signaling pathway
hsa04380	Osteoclast differentiation
hsa05010	Alzheimer disease
hsa05014	Amyotrophic lateral sclerosis
hsa05418	Fluid shear stress and atherosclerosis
hsa04932	Non-alcoholic fatty liver disease
hsa04931	Insulin resistance
hsa05130	Pathogenic Escherichia coli infection
hsa05152	Tuberculosis
hsa05166	Human T-cell leukemia virus 1 infection
hsa05170	Human immunodeficiency virus 1 infection
hsa05164	Influenza A
hsa05160	Hepatitis C
hsa05168	Herpes simplex virus 1 infection
hsa05163	Human cytomegalovirus infection
hsa05167	Kaposi sarcoma-associated herpesvirus infection
hsa05165	Human papillomavirus infection
hsa05145	Toxoplasmosis
hsa05142	Chagas disease

Diseases

Associated diseases	References
Cancer	GAD: 15146559
Cancer (bladder)	GAD: 19692168
Cancer (breast)	GAD: 19890662
Cancer (esophageal)	GAD: 20453000
Cancer (glaucoma)	GAD: 19556827
Cancer (lung)	GAD: 18676680
Cancer (lymphoma)	GAD: 15146559
Cancer (myeloma)	GAD: 20568250
Cancer (Squamous cell)	GAD: 18206417
Atherosclerosis	GAD: 17346438
Cardiovascular disease	GAD: 14694358
Myocardial Infarction	GAD: 14694358
Restenosis	GAD: 12082592
Thrombosis	GAD: 15692984
Congenital abnormalities	GAD: 20098615
Cystic fibrosis	GAD: 16463024
Liver disease	GAD: 21399635
Uveitis	GAD: 15851552
Anemia	GAD: 16142859
Arthritis	GAD: 11212177
Inflammatory bowel disease	GAD: 18338763
Rheumatoid arthritis	GAD: 14872483
Psoriatic arthritis	GAD: 17530646
Systemic lupus erythematosus (SLE)	GAD: 18174230
Systemic lupus erythematosus (SLE)	GAD: 12126589
Multiple sclerosis	KEGG: H01490
Crohn's disease	GAD: 15586174
Amyloidosis	GAD: 12105243
Diabetes	GAD: 15787661
Hypercholesterolemia	GAD: 20602615
Obesity	GAD: 17200772
Bone diseases	GAD: 19453261
Osteoarthritis	GAD: 16282562
Osteoporosis	GAD: 19369902
Rheumatic diseases	GAD: 17763205
Alzheimer's disease	GAD: 19141999
Parkinson disease	GAD: 11072751
Cirrhosis	GAD: 11196686
Schizophrenia	GAD: 19193342
Abortion	GAD: 17686637
Chorioamnionitis	GAD: 20452482
Preterm birth risk	GAD: 16731080
Defective endometrial receptivity	INFBASE: 25935494
Endometriosis	INFBASE: 19238748
Polycystic ovary syndrome (PCOS)	INFBASE: 24423322
Impaired human spermatogenesis	MIK: 19527232
Male factor infertility	MIK: 19527232
Chronic obstructive pulmonary disease (COPD)	GAD: 12661999
Connective tissue diseases	GAD: 19527514
Tumor necrosis factor receptor-associated periodic syndrome	KEGG: H00912
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Spermatogenic defects	MIK: 19527232
Male infertility	MIK: 8632606

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
19527232	Male infertility			10 patients obtained from patients who had undergone orchidec-tomy resulting from prostatic cancer treatment	Male infertility	IL-6 IL-10  TNF-alpha TNFR1 and TNFR2
19527232	Impaired human spermatogenesis			39 (10 controls, 29 azoospermic patients (9 Sertoli cell only syndrome, 7 undefined maturation arrest, 4 maturation arrest at a spermatocyte stage, 3 maturation arrest at a spermatid stage and OA, 6 obstructive azospermia ) )	Male infertility	IL-6 IL-10 TNF-alpha TNFR1 and TNFR2
8632606	Male infertility	p55-sTNF-R, p75-sTNF-R			Male infertility
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
8752625	Male infertility			69 (15 controls, 12 azoospermic men, 20 men with oligoteratoasthenospermia, 11 men with oligoteratoasthenospermia and genital infection)	Male infertility	TNF-I receptor TNF-II