• Gene id: 7130

Gene Summary

• Gene Symbol: TNFAIP6   Gene   UCSC   Ensembl
• Aliases: TSG-6, TSG6
• Gene name: TNF alpha induced protein 6
• Alternate names: tumor necrosis factor-inducible gene 6 protein, TNF-stimulated gene 6 protein, hyaluronate-binding protein, tumor necrosis factor alpha-inducible protein 6, tumor necrosis factor, alpha induced protein 6, tumor necrosis factor-stimulated gene-6 protein,
• Gene location: 2q23.3 (119080816: 119033669)     Exons: 22     NC_000010.11
• Gene summary(Entrez): The protein encoded by this gene is a secretory protein that contains a hyaluronan-binding domain, and thus is a member of the hyaluronan-binding protein family. The hyaluronan-binding domain is known to be involved in extracellular matrix stability and c
• OMIM: 600410

Protein Summary

• Protein general information: P98066  
  • Name: Tumor necrosis factor inducible gene 6 protein (Hyaluronate binding protein) (TNF stimulated gene 6 protein) (TSG 6) (Tumor necrosis factor alpha induced protein 6) (TNF alpha induced protein 6)
  • Length: 277  
  • Mass: 31203
  • Tissue specificity: Found in the synovial fluid of patients with rheumatoid arthritis. {ECO
• Sequence:

  MIILIYLFLLLWEDTQGWGFKDGIFHNSIWLERAAGVYHREARSGKYKLTYAEAKAVCEFEGGHLATYKQLEAAR
  KIGFHVCAAGWMAKGRVGYPIVKPGPNCGFGKTGIIDYGIRLNRSERWDAYCYNPHAKECGGVFTDPKQIFKSPG
  FPNEYEDNQICYWHIRLKYGQRIHLSFLDFDLEDDPGCLADYVEIYDSYDDVHGFVGRYCGDELPDDIISTGNVM
  TLKFLSDASVTAGGFQIKYVAMDPVSKSSQGKNTSTTSTGNKNFLAGRFSHL

• Structural information:
  • Protein Domains: (36..12-)
    (/note="Link-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00323-)
    (135..24-)
    (/note="CUB-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00059"-)
  • Interpro: IPR016186  IPR016187  IPR000859  IPR000538  IPR035914  
  • Prosite: PS01180 PS01241 PS50963
  • CDD: cd00041
  • PDB: 1O7B 1O7C 2N40 2PF5 2WNO
  • PDBsum: 1O7B 1O7C 2N40 2PF5 2WNO
  • STRING: ENSP00000243347
• Other Databases: GeneCards:  TNFAIP6  Malacards:  TNFAIP6

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0050728	negative regulation of inflammatory response	IDA	biological process
GO:0050728	negative regulation of inflammatory response	IBA	biological process
GO:0005615	extracellular space	IBA	cellular component
GO:0005540	hyaluronic acid binding	IEA	molecular function
GO:0007155	cell adhesion	IEA	biological process
GO:0007155	cell adhesion	IEA	biological process
GO:0005540	hyaluronic acid binding	TAS	molecular function
GO:0006954	inflammatory response	TAS	biological process
GO:0007165	signal transduction	TAS	biological process
GO:0007267	cell-cell signaling	TAS	biological process
GO:0043312	neutrophil degranulation	TAS	biological process
GO:1904724	tertiary granule lumen	TAS	cellular component
GO:1904813	ficolin-1-rich granule lumen	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005615	extracellular space	IEA	cellular component
GO:0030335	positive regulation of cell migration	IEA	biological process
GO:0030728	ovulation	IEA	biological process

Diseases

Associated diseases	References
Corneal neovascularization	PMID:20837529
Atopic dermatitis	PMID:16650051
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R