• Gene id: 7123

Gene Summary

• Gene Symbol: CLEC3B   Gene   UCSC   Ensembl
• Aliases: TN, TNA
• Gene name: C-type lectin domain family 3 member B
• Alternate names: tetranectin, plasminogen kringle 4-binding protein, tetranectin (plasminogen-binding protein),
• Gene location: 3p21.31 (45026206: 45036070)     Exons: 5     NC_000003.12
• OMIM: 140050

Protein Summary

• Protein general information: P05452  
  • Name: Tetranectin (TN) (C type lectin domain family 3 member B) (Plasminogen kringle 4 binding protein)
  • Length: 202  
  • Mass: 22537
  • Tissue specificity: Found in plasma.
• Sequence:

  MELWGAYLLLCLFSLLTQVTTEPPTQKPKKIVNAKKDVVNTKMFEELKSRLDTLAQEVALLKEQQALQTVCLKGT
  KVHMKCFLAFTQTKTFHEASEDCISRGGTLGTPQTGSENDALYEYLRQSVGNEAEIWLGLNDMAAEGTWVDMTGA
  RIAYKNWETEITAQPDGGKTENCAVLSGAANGKWFDKRCRDQLPYICQFGIV

• Structural information:
  • Protein Domains: (77..19-)
    (/note="C-type-lectin)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00040"-)
  • Interpro: IPR001304  IPR016186  IPR018378  IPR016187  
  • Prosite: PS00615 PS50041
  • PDB: 1HTN 1RJH 1TN3 3L9J
  • PDBsum: 1HTN 1RJH 1TN3 3L9J
  • STRING: ENSP00000296130
• Other Databases: GeneCards:  CLEC3B  Malacards:  CLEC3B

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0001503	ossification	IBA	biological process
GO:0005615	extracellular space	IBA	cellular component
GO:0030282	bone mineralization	IBA	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0030246	carbohydrate binding	IEA	molecular function
GO:0002576	platelet degranulation	TAS	biological process
GO:0031089	platelet dense granule lumen	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0001503	ossification	IEA	biological process
GO:0005615	extracellular space	HDA	cellular component
GO:0062023	collagen-containing extracellular matrix	ISS	colocalizes with
GO:0062023	collagen-containing extracellular matrix	HDA	cellular component
GO:0005576	extracellular region	HDA	cellular component
GO:0005576	extracellular region	IEA	cellular component
GO:0005615	extracellular space	IDA	cellular component
GO:0001652	granular component	IDA	cellular component
GO:0030282	bone mineralization	IDA	biological process
GO:0008201	heparin binding	IDA	molecular function
GO:0005737	cytoplasm	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005615	extracellular space	IDA	cellular component
GO:0005509	calcium ion binding	IDA	molecular function
GO:0005737	cytoplasm	IDA	cellular component
GO:0010756	positive regulation of plasminogen activation	ISS	biological process
GO:0001503	ossification	IEP	biological process
GO:0030282	bone mineralization	IEP	biological process
GO:0070062	extracellular exosome	HDA	cellular component
GO:0071560	cellular response to transforming growth factor beta stimulus	IEP	biological process
GO:0071310	cellular response to organic substance	IEP	biological process
GO:0005576	extracellular region	NAS	cellular component
GO:0036143	kringle domain binding	IPI	molecular function
GO:0001503	ossification	IBA	biological process
GO:0005615	extracellular space	IBA	cellular component
GO:0030282	bone mineralization	IBA	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0030246	carbohydrate binding	IEA	molecular function
GO:0002576	platelet degranulation	TAS	biological process
GO:0031089	platelet dense granule lumen	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0001503	ossification	IEA	biological process
GO:0005615	extracellular space	HDA	cellular component
GO:0062023	collagen-containing extracellular matrix	ISS	colocalizes with
GO:0062023	collagen-containing extracellular matrix	HDA	cellular component
GO:0005576	extracellular region	HDA	cellular component
GO:0005576	extracellular region	IEA	cellular component
GO:0005615	extracellular space	IDA	cellular component
GO:0001652	granular component	IDA	cellular component
GO:0030282	bone mineralization	IDA	biological process
GO:0008201	heparin binding	IDA	molecular function
GO:0005737	cytoplasm	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005615	extracellular space	IDA	cellular component
GO:0005509	calcium ion binding	IDA	molecular function
GO:0005737	cytoplasm	IDA	cellular component
GO:0010756	positive regulation of plasminogen activation	ISS	biological process
GO:0001503	ossification	IEP	biological process
GO:0030282	bone mineralization	IEP	biological process
GO:0070062	extracellular exosome	HDA	cellular component
GO:0071560	cellular response to transforming growth factor beta stimulus	IEP	biological process
GO:0071310	cellular response to organic substance	IEP	biological process
GO:0005576	extracellular region	NAS	cellular component
GO:0036143	kringle domain binding	IPI	molecular function

Diseases

Associated diseases	References
Osteoarthritis	PMID:15334463
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq