• Gene id: 7114

Gene Summary

• Gene Symbol: TMSB4X   Gene   UCSC   Ensembl
• Aliases: FX, PTMB4, TB4X, TMSB4
• Gene name: thymosin beta 4, X-linked
• Alternate names: thymosin beta-4, prothymosin beta-4, t beta-4, thymosin, beta 4, X chromosome,
• Gene location: Xp22.2 (113056790: 113041814)     Exons: 4     NC_000009.12
• Gene summary(Entrez): This gene encodes an actin sequestering protein which plays a role in regulation of actin polymerization. The protein is also involved in cell proliferation, migration, and differentiation. This gene escapes X inactivation and has a homolog on chromosome
• OMIM: 300159

Protein Summary

• Protein general information: P62328  
  • Name: Thymosin beta 4 (T beta 4) (Fx) [Cleaved into: Hematopoietic system regulatory peptide (Seraspenide)]
  • Length: 44  
  • Mass: 5,053
• Sequence:

  MSDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES

• Structural information:
  • Interpro: IPR001152  IPR038386  
  • Prosite: PS00500
  • PDB: 1UY5 3TU5 4PL7 4PL8
  • PDBsum: 1UY5 3TU5 4PL7 4PL8
  • STRING: ENSP00000370007
• Other Databases: GeneCards:  TMSB4X  Malacards:  TMSB4X

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0001649	osteoblast differentiation	IEA	biological process
GO:0002576	platelet degranulation	TAS	biological process
GO:0003785	actin monomer binding	IEA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005576	extracellular region	TAS	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005829	cytosol	IEA	cellular component
GO:0005856	cytoskeleton	IEA	cellular component
GO:0007015	actin filament organization	IEA	biological process
GO:0030334	regulation of cell migration	IEA	biological process
GO:0031093	platelet alpha granule lumen	TAS	cellular component
GO:0044822	poly(A) RNA binding	IDA	molecular function
GO:0001649	osteoblast differentiation	IEA	biological process
GO:0002576	platelet degranulation	TAS	biological process
GO:0003779	actin binding	IEA	molecular function
GO:0003785	actin monomer binding	IEA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005576	extracellular region	TAS	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005829	cytosol	IEA	cellular component
GO:0005856	cytoskeleton	IEA	cellular component
GO:0005856	cytoskeleton	IEA	cellular component
GO:0007015	actin filament organization	IEA	biological process
GO:0030334	regulation of cell migration	IEA	biological process
GO:0031093	platelet alpha granule lumen	TAS	cellular component
GO:0044822	poly(A) RNA binding	IDA	molecular function
GO:0002576	platelet degranulation	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005576	extracellular region	TAS	cellular component
GO:0031093	platelet alpha granule lumen	TAS	cellular component
GO:0044822	poly(A) RNA binding	IDA	molecular function

KEGG pathways

Pathway id	Pathway name
hsa04810	Regulation of actin cytoskeleton

Diseases

Associated diseases	References
Cancer	GAD: 12970751
Cancer (lung)	GAD: 12970751
Male factor infertility	MIK: 15120973
Male infertility	MIK: 15120973
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
15120973	Male infertility			8 testis biopsies	Male infertility	Vim Rad23A Rad23B Gsr Gstp 1 Mgst1 Ace Casp1 Ctsd Prlr Tmsb4 and Zfp-37 Hsp 1 Osp94
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)