• Gene id: 7113

Gene Summary

• Gene Symbol: TMPRSS2   Gene   UCSC   Ensembl
• Aliases: PRSS10
• Gene name: transmembrane serine protease 2
• Alternate names: transmembrane protease serine 2, epitheliasin, serine protease 10, transmembrane protease, serine 2,
• Gene location: 21q22.3 (41508157: 41464304)     Exons: 12     NC_000021.9
• Gene summary(Entrez): This gene encodes a protein that belongs to the serine protease family. The encoded protein contains a type II transmembrane domain, a receptor class A domain, a scavenger receptor cysteine-rich domain and a protease domain. Serine proteases are known to
• OMIM: 602060

Protein Summary

• Protein general information: O15393  
  • Name: Transmembrane protease serine 2 (EC 3.4.21. ) (Serine protease 10) [Cleaved into: Transmembrane protease serine 2 non catalytic chain; Transmembrane protease serine 2 catalytic chain]
  • Length: 492  
  • Mass: 53859
  • Tissue specificity: Expressed in several tissues that comprise large populations of epithelial cells with the highest level of transcripts measured in the prostate gland. Expressed in type II pneumocytes in the lung (at protein level). Expressed strongly
• Sequence:

  MALNSGSPPAIGPYYENHGYQPENPYPAQPTVVPTVYEVHPAQYYPSPVPQYAPRVLTQASNPVVCTQPKSPSGT
  VCTSKTKKALCITLTLGTFLVGAALAAGLLWKFMGSKCSNSGIECDSSGTCINPSNWCDGVSHCPGGEDENRCVR
  LYGPNFILQVYSSQRKSWHPVCQDDWNENYGRAACRDMGYKNNFYSSQGIVDDSGSTSFMKLNTSAGNVDIYKKL
  YHSDACSSKAVVSLRCIACGVNLNSSRQSRIVGGESALPGAWPWQVSLHVQNVHVCGGSIITPEWIVTAAHCVEK
  PLNNPWHWTAFAGILRQSFMFYGAGYQVEKVISHPNYDSKTKNNDIALMKLQKPLTFNDLVKPVCLPNPGMMLQP
  EQLCWISGWGATEEKGKTSEVLNAAKVLLIETQRCNSRYVYDNLITPAMICAGFLQGNVDSCQGDSGGPLVTSKN
  NIWWLIGDTSWGSGCAKAYRPGVYGNVMVFTDWIYRQMRADG

• Structural information:
  • Protein Domains: (112..14-)
    A (/note="LDL-receptor-class)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00124-)
    (150..24-)
    (/note="SRCR-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00196-)
    (256..48-)
    (/note="Peptidase-S1)
    (/evidence="ECO:0000255|PROSITE-P-)
  • Interpro: IPR036055  IPR023415  IPR002172  IPR009003  IPR001314   IPR001190  IPR017448  IPR036772  IPR001254  IPR018114  IPR033116  
  • Prosite: PS01209 PS50068 PS50287 PS50240 PS00134 PS00135
  • CDD: cd00112 cd00190
  • STRING: ENSP00000381588
• Other Databases: GeneCards:  TMPRSS2  Malacards:  TMPRSS2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0016540	protein autoprocessing	IBA	biological process
GO:0006508	proteolysis	IDA	biological process
GO:0006508	proteolysis	IDA	biological process
GO:0046598	positive regulation of viral entry into host cell	IDA	biological process
GO:0046598	positive regulation of viral entry into host cell	IDA	biological process
GO:0005886	plasma membrane	IDA	cellular component
GO:0016540	protein autoprocessing	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0004252	serine-type endopeptidase activity	IEA	molecular function
GO:0006508	proteolysis	IEA	biological process
GO:0005044	scavenger receptor activity	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0005576	extracellular region	IEA	cellular component
GO:0008233	peptidase activity	IEA	molecular function
GO:0006508	proteolysis	IEA	biological process
GO:0016787	hydrolase activity	IEA	molecular function
GO:0008236	serine-type peptidase activity	IEA	molecular function
GO:0005886	plasma membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0008236	serine-type peptidase activity	TAS	molecular function
GO:0005887	integral component of plasma membrane	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0006508	proteolysis	IEA	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0006897	endocytosis	IEA	biological process
GO:0070062	extracellular exosome	HDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa05202	Transcriptional misregulation in cancer
hsa05164	Influenza A
hsa05215	Prostate cancer

Diseases

Associated diseases	References
Prostatic hypertrophy	PMID:18338334
prostate adenocarcinoma	PMID:18338334
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq