• Gene id: 7107

Gene Summary

• Gene Symbol: GPR137B   Gene   UCSC   Ensembl
• Aliases: TM7SF1
• Gene name: G protein-coupled receptor 137B
• Alternate names: integral membrane protein GPR137B, transmembrane 7 superfamily member 1 (upregulated in kidney), transmembrane 7 superfamily member 1 protein,
• Gene location: 1q42.3 (236142528: 236213534)     Exons: 7     NC_000001.11
• OMIM: 604658

Protein Summary

• Protein general information: O60478  
  • Name: Integral membrane protein GPR137B (Transmembrane 7 superfamily member 1 protein)
  • Length: 399  
  • Mass: 45599
  • Tissue specificity: Expressed in kidney, heart, brain and placenta. {ECO
• Sequence:

  MRPERPRPRGSAPGPMETPPWDPARNDSLPPTLTPAVPPYVKLGLTVVYTVFYALLFVFIYVQLWLVLRYRHKRL
  SYQSVFLFLCLFWASLRTVLFSFYFKDFVAANSLSPFVFWLLYCFPVCLQFFTLTLMNLYFTQVIFKAKSKYSPE
  LLKYRLPLYLASLFISLVFLLVNLTCAVLVKTGNWERKVIVSVRVAINDTLFVLCAVSLSICLYKISKMSLANIY
  LESKGSSVCQVTAIGVTVILLYTSRACYNLFILSFSQNKSVHSFDYDWYNVSDQADLKNQLGDAGYVLFGVVLFV
  WELLPTTLVVYFFRVRNPTKDLTNPGMVPSHGFSPRSYFFDNPRRYDSDDDLAWNIAPQGLQGGFAPDYYDWGQQ
  TNSFLAQAGTLQDSTLDPDKPSLG

• Structural information:
  • Interpro: IPR029723  
  • STRING: ENSP00000355551
• Other Databases: GeneCards:  GPR137B  Malacards:  GPR137B

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0045779	negative regulation of bone resorption	IBA	biological process
GO:0005765	lysosomal membrane	IBA	cellular component
GO:0010506	regulation of autophagy	IBA	biological process
GO:0045671	negative regulation of osteoclast differentiation	IBA	biological process
GO:1904263	positive regulation of TORC1 signaling	IBA	biological process
GO:0005765	lysosomal membrane	IDA	cellular component
GO:0010506	regulation of autophagy	IMP	biological process
GO:0150032	positive regulation of protein localization to lysosome	IMP	biological process
GO:1904263	positive regulation of TORC1 signaling	IMP	biological process
GO:0045671	negative regulation of osteoclast differentiation	ISS	biological process
GO:0043087	regulation of GTPase activity	IMP	biological process
GO:0045779	negative regulation of bone resorption	ISS	biological process
GO:0043030	regulation of macrophage activation	ISS	biological process
GO:0005764	lysosome	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0006914	autophagy	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005887	integral component of plasma membrane	TAS	cellular component
GO:0016020	membrane	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005765	lysosomal membrane	IEA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq