• Gene id: 7105

Gene Summary

• Gene Symbol: TSPAN6   Gene   UCSC   Ensembl
• Aliases: T245, TM4SF6, TSPAN-6
• Gene name: tetraspanin 6
• Alternate names: tetraspanin-6, A15 homolog, putative NF-kappa-B-activating protein 321, tetraspan TM4SF, tetraspanin TM4-D, transmembrane 4 superfamily member 6,
• Gene location: Xq22.1 (100637103: 100627107)     Exons: 9     NC_000023.11
• Gene summary(Entrez): The protein encoded by this gene is a member of the transmembrane 4 superfamily, also known as the tetraspanin family. Most of these members are cell-surface proteins that are characterized by the presence of four hydrophobic domains. The proteins mediate
• OMIM: 300191

Protein Summary

• Protein general information: O43657  
  • Name: Tetraspanin 6 (Tspan 6) (A15 homolog) (Putative NF kappa B activating protein 321) (T245 protein) (Tetraspanin TM4 D) (Transmembrane 4 superfamily member 6)
  • Length: 245  
  • Mass: 27563
• Sequence:

  MASPSRRLQTKPVITCFKSVLLIYTFIFWITGVILLAVGIWGKVSLENYFSLLNEKATNVPFVLIATGTVIILLG
  TFGCFATCRASAWMLKLYAMFLTLVFLVELVAAIVGFVFRHEIKNSFKNNYEKALKQYNSTGDYRSHAVDKIQNT
  LHCCGVTDYRDWTDTNYYSEKGFPKSCCKLEDCTPQRDADKVNNEGCFIKVMTIIESEMGVVAGISFGVACFQLI
  GIFLAYCLSRAITNNQYEIV

• Structural information:
  • Interpro: IPR000301  IPR018499  IPR018503  IPR008952  
  • Prosite: PS00421
  • STRING: ENSP00000362111
• Other Databases: GeneCards:  TSPAN6  Malacards:  TSPAN6

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005887	integral component of plasma membrane	IBA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:1901223	negative regulation of NIK/NF-kappaB signaling	IDA	biological process
GO:0070062	extracellular exosome	HDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0039532	negative regulation of viral-induced cytoplasmic pattern recognition receptor signaling pathway	IMP	biological process
GO:0043123	positive regulation of I-kappaB kinase/NF-kappaB signaling	HMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0070062	extracellular exosome	HDA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Hypospermatogenesis	MIK: 28361989
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28361989	Hypospermatogenesis			6 (3 controls, 3 Klienfelter syndrome	Male infertility	Microarray
31037746	Spermatogenic defects			28 men with azoospermia	Male infertility	Microarray