Search Result
Gene id | 7101 | ||||||||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Gene Summary Protein Summary Gene ontology Diseases PubMed | |||||||||||||||||
Gene Summary |
|||||||||||||||||
Gene Symbol | NR2E1 Gene UCSC Ensembl | ||||||||||||||||
Aliases | TLL, TLX, XTLL | ||||||||||||||||
Gene name | nuclear receptor subfamily 2 group E member 1 | ||||||||||||||||
Alternate names | nuclear receptor subfamily 2 group E member 1, nuclear receptor TLX, protein tailless homolog, tailes-related receptor, tailless, | ||||||||||||||||
Gene location |
6q21 (108166021: 108188808) Exons: 10 NC_000006.12 |
||||||||||||||||
Gene summary(Entrez) |
The protein encoded by this gene is an orphan receptor involved in retinal development. The encoded protein also regulates adult neural stem cell proliferation and may be involved in control of aggressive behavior. Two transcript variants encoding differe |
||||||||||||||||
OMIM | 603849 | ||||||||||||||||
Protein Summary |
|||||||||||||||||
Protein general information | Q9Y466 Name: Nuclear receptor subfamily 2 group E member 1 (Nuclear receptor TLX) (Protein tailless homolog) (Tll) (hTll) Length: 385 Mass: 42589 Tissue specificity: Brain specific. Present in all brain sections tested, highest levels in the caudate nucleus and hippocampus, weakest levels in the thalamus. {ECO | ||||||||||||||||
Sequence |
MSKPAGSTSRILDIPCKVCGDRSSGKHYGVYACDGCSGFFKRSIRRNRTYVCKSGNQGGCPVDKTHRNQCRACRL KKCLEVNMNKDAVQHERGPRTSTIRKQVALYFRGHKEENGAAAHFPSAALPAPAFFTAVTQLEPHGLELAAVSTT PERQTLVSLAQPTPKYPHEVNGTPMYLYEVATESVCESAARLLFMSIKWAKSVPAFSTLSLQDQLMLLEDAWREL FVLGIAQWAIPVDANTLLAVSGMNGDNTDSQKLNKIISEIQALQEVVARFRQLRLDATEFACLKCIVTFKAVPTH SGSELRSFRNAAAIAALQDEAQLTLNSYIHTRYPTQPCRFGKLLLLLPALRSISPSTIEEVFFKKTIGNVPITRL LSDMYKSSDI | ||||||||||||||||
Structural information |
| ||||||||||||||||
Other Databases | GeneCards: NR2E1 Malacards: NR2E1 | ||||||||||||||||
Gene ontologyExpand All | Collapse All |
|||||||||||||||||
| |||||||||||||||||
Diseases
|
|||||||||||||||||
| |||||||||||||||||
PubMed referencesExpand All | Collapse All |
|||||||||||||||||
|