• Gene id: 71

Gene Summary

• Gene Symbol: ACTG1   Gene   UCSC   Ensembl
• Aliases: ACT, ACTG, DFNA20, DFNA26, HEL-176
• Gene name: actin gamma 1
• Alternate names: actin, cytoplasmic 2, cytoskeletal gamma-actin, epididymis luminal protein 176,
• Gene location: 17q25.3 (81512798: 81509970)     Exons: 7     NC_000017.11
• Gene summary(Entrez): Actins are highly conserved proteins that are involved in various types of cell motility and in maintenance of the cytoskeleton. Three main groups of actin isoforms have been identified in vertebrate animals: alpha, beta, and gamma. The alpha actins are f
• OMIM: 609275

SNPs

rs587777031

Strand:    Allele origin:   Allele change:   Mutation type: delins

NC_000010.11   g.119030032_119030034CTC[1]
NC_000010.11   g.119030032_119030034CTC[3]
NC_000010.11   g.119030032_119030034CTC[5]
NC_000010.10   g.120789544_120789546CTC[1]
NC_000010.10   g.120789544_120789546CTC[3]
NC_000010.10   g.120789544_120789546CTC[5]
NG_0  

rs62180545

Strand:    Allele origin:   Allele change:   Mutation type: snv

NC_000002.12   g.216859821A>G
NC_000002.11   g.217724544A>G|SEQ=[A/G]|GENE=TNP1
LOC101928278   101928278

rs35576928

Strand:    Allele origin:   Allele change:   Mutation type: snv

NC_000016.10   g.11281137C>A
NC_000016.10   g.11281137C>G
NC_000016.9   g.11374994C>A
NC_000016.9   g.11374994C>G
NM_002761.3   c.102G>T
NM_002761.3   c.102G>C
NM_002761.2   c.102G>T
NM_002761.2   c.102G>C
NP_002752.1   p.Arg34Ser
NP_002752.1   p.Arg34Ser|SEQ=[C/A/G]|GE

rs17840762

Strand:    Allele origin:   Allele change:   Mutation type: snv

NC_000009.12   g.125241708G>A
NC_000009.11   g.128003987G>A
NG_027761.1   g.4680C>T
NG_063123.1   g.439G>A
XR_001746927.1   n.46G>A|SEQ=[G/A]|GENE=HSPA5
LOC107987127   107987127

rs17840761

Strand:    Allele origin:   Allele change:   Mutation type: snv

NC_000009.12   g.125241700G>A
NC_000009.11   g.128003979G>A
NG_027761.1   g.4688C>T
NG_063123.1   g.431G>A
XR_001746927.1   n.38G>A|SEQ=[G/A]|GENE=HSPA5
LOC107987127   107987127

rs11204546

Strand:    Allele origin:   Allele change:   Mutation type: snv

NC_000001.11   g.247896410T>A
NC_000001.11   g.247896410T>C
NC_000001.11   g.247896410T>G
NC_000001.10   g.248059712T>A
NC_000001.10   g.248059712T>C
NC_000001.10   g.248059712T>G
NG_053132.1   g.5824T>A
NG_053132.1   g.5824T>C
NG_053132.1   g.5824T>G
NM_001001957.2   c

rs7004637

Strand:    Allele origin:   Allele change:   Mutation type: snv

NC_000008.11   g.42392929A>G
NC_000008.10   g.42250447A>G|SEQ=[A/G]|GENE=VDAC3
DKK4   27121

rs6124715

Strand:    Allele origin:   Allele change:   Mutation type: snv

NC_000020.11   g.45548848C>G
NC_000020.11   g.45548848C>T
NC_000020.10   g.44177487C>G
NC_000020.10   g.44177487C>T|SEQ=[C/G/T]|GENE=EPPIN
EPPIN-WFDC6   100526773

rs3216733

Strand:    Allele origin:   Allele change:   Mutation type: delins

NC_000009.12   g.125241516_125241517del
NC_000009.12   g.125241517del
NC_000009.12   g.125241517dup
NC_000009.12   g.125241516_125241517dup
NC_000009.11   g.128003795_128003796del
NC_000009.11   g.128003796del
NC_000009.11   g.128003796dup
NC_000009.11   g.128003795

rs2301365

Strand:    Allele origin:   Allele change:   Mutation type: snv

NC_000016.10   g.11281429G>T
NC_000016.9   g.11375286G>T|SEQ=[G/T]|GENE=PRM1
LOC105371082   105371082

rs2287498

Strand:    Allele origin:   Allele change:   Mutation type: snv

NC_000017.11   g.7689242C>T
NC_000017.10   g.7592560C>T
NG_017013.2   g.3309G>A
NG_028245.1   g.8172C>T
NM_018081.2   c.450C>T
NM_001143991.2   c.450C>T
NM_001143991.1   c.450C>T
NM_001143992.2   c.450C>T
NM_001143992.1   c.450C>T
NM_001143990.1   c.450C>T
XR_001752551.  

rs2227290

Strand:    Allele origin:   Allele change:   Mutation type: snv

NC_000020.11   g.45547503G>C
NC_000020.11   g.45547503G>T
NC_000020.10   g.44176142G>C
NC_000020.10   g.44176142G>T|SEQ=[G/C/T]|GENE=EPPIN
EPPIN-WFDC6   100526773

rs2070923

Strand:    Allele origin:   Allele change:   Mutation type: snv

NC_000016.10   g.11275998G>C
NC_000016.10   g.11275998G>T
NC_000016.9   g.11369855G>C
NC_000016.9   g.11369855G>T|SEQ=[G/C/T]|GENE=PRM2
LOC105371082   105371082

rs1893316

Strand:    Allele origin:   Allele change:   Mutation type: snv

NC_000011.10   g.66026326G>A
NC_000011.9   g.65793797G>A
NG_016285.1   g.5192C>T
NM_053054.4   c.54C>T
NM_053054.3   c.54C>T
XR_949785.2   n.192C>T
XR_949787.2   n.193C>T
XR_002957121.1   n.192C>T
XR_002957122.1   n.193C>T|SEQ=[G/A]|GENE=CATSPER1

rs1646022

Strand:    Allele origin:   Allele change:   Mutation type: snv

NC_000016.10   g.11276073C>G
NC_000016.10   g.11276073C>T
NC_000016.9   g.11369930C>G
NC_000016.9   g.11369930C>T
NM_001286359.1   c.298G>C
NM_001286359.1   c.298G>A
NM_001286359.2   c.298G>C
NM_001286359.2   c.298G>A
NP_001273288.1   p.Ala100Pro
NP_001273288.1   p.Ala1

rs737008

Strand:    Allele origin:   Allele change:   Mutation type: snv

NC_000016.10   g.11281009G>A
NC_000016.10   g.11281009G>T
NC_000016.9   g.11374866G>A
NC_000016.9   g.11374866G>T
NM_002761.3   c.139C>T
NM_002761.3   c.139C>A
NM_002761.2   c.139C>T
NM_002761.2   c.139C>A
NP_002752.1   p.Arg47Ter|SEQ=[G/A/T]|GENE=PRM1
LOC1053710  

rs16937456

Strand:    Allele origin:   Allele change:   Mutation type: snv

NC_000008.11   g.71165720A>G
NC_000008.11   g.71165720A>T
NC_000008.10   g.72077955A>G
NC_000008.10   g.72077955A>T|SEQ=[A/G/T]|GENE=LOC105375894

rs36065902

Strand:    Allele origin:   Allele change:   Mutation type: snv

NC_000017.11   g.41841870A>T
NW_003571052.1   g.128512A>T
NG_051246.1   g.11186A>T
NM_152467.5   c.242A>T
NM_152467.4   c.242A>T
NM_152467.3   c.242A>T
NM_001329596.2   c.-23A>T
NM_001329596.1   c.-23A>T
NM_001329595.1   c.242A>T
NC_000017.10   g.39998122A>T
NP_689680.2  

rs61752339

Strand:    Allele origin:   Allele change:   Mutation type: snv

NC_000017.11   g.41845328T>C
NW_003571052.1   g.131970T>C
NG_051246.1   g.14644T>C
NM_152467.5   c.887T>C
NM_152467.4   c.887T>C
NM_152467.3   c.887T>C
NM_001329596.2   c.623T>C
NM_001329596.1   c.623T>C
NM_001329595.1   c.887T>C
NC_000017.10   g.40001580T>C
NP_689680.2  

rs79170274

Strand:    Allele origin:   Allele change:   Mutation type: snv

NC_000010.11   g.119030036T>A
NC_000010.11   g.119030036T>C
NC_000010.10   g.120789548T>A
NC_000010.10   g.120789548T>C
NG_050764.1   g.5321T>A
NG_050764.1   g.5321T>C
NM_199461.4   c.235T>A
NM_199461.4   c.235T>C
NM_199461.3   c.235T>A
NM_199461.3   c.235T>C
NM_199461.  

rs7562326

Strand:    Allele origin:   Allele change:   Mutation type: snv

NC_000002.12   g.31573695T>A
NC_000002.12   g.31573695T>C
NC_000002.11   g.31798765T>A
NC_000002.11   g.31798765T>C
NG_008365.1   g.12277A>T
NG_008365.1   g.12277A>G|SEQ=[T/A/C]|GENE=SRD5A2

rs1106042

Strand:    Allele origin:   Allele change:   Mutation type: snv

NC_000012.12   g.130357093G>A
NC_000012.11   g.130841638G>A
NT_187589.1   g.34018G>A
NM_004764.4   c.1580G>A
NM_004764.5   c.1580G>A
XM_011539004.3   c.1580G>A
XM_011539002.3   c.1580G>A
XM_011539003.3   c.1580G>A
XM_011539006.3   c.440G>A
XM_011539005.1   c.1580G>A
XM_  

rs1042522

Strand:    Allele origin:   Allele change:   Mutation type: snv

NC_000017.11   g.7676154G>A
NC_000017.11   g.7676154G>C
NC_000017.11   g.7676154G>T
NC_000017.10   g.7579472G>A
NC_000017.10   g.7579472G>C
NC_000017.10   g.7579472G>T
NG_017013.2   g.16397C>T
NG_017013.2   g.16397C>G
NG_017013.2   g.16397C>A
NM_000546.6   c.215C>T
NM_0  

rs523349

Strand:    Allele origin:   Allele change:   Mutation type: snv

NC_000002.12   g.31580636G>A
NC_000002.12   g.31580636G>C
NC_000002.12   g.31580636G>T
NC_000002.11   g.31805706G>A
NC_000002.11   g.31805706G>C
NC_000002.11   g.31805706G>T
NG_008365.1   g.5336C>T
NG_008365.1   g.5336C>G
NG_008365.1   g.5336C>A
NM_000348.4   c.265C>T
N  

rs1800629

Strand:    Allele origin:   Allele change:   Mutation type: snv

NC_000006.12   g.31575254G>A
NC_000006.11   g.31543031G>A
NG_007462.1   g.4682G>A
NG_012010.1   g.8156G>A
NT_113891.3   g.3052541A>G
NT_113891.2   g.3052647A>G
NT_167246.2   g.2880295G>A
NT_167246.1   g.2885915G>A
NT_167249.2   g.2874534G>A
NT_167249.1   g.2873832G>A
NT  

rs1799964

Strand:    Allele origin:   Allele change:   Mutation type: snv

NC_000006.12   g.31574531T>C
NC_000006.11   g.31542308T>C
NG_007462.1   g.3959T>C
NG_012010.1   g.7433T>C
NT_113891.3   g.3051818T>C
NT_113891.2   g.3051924T>C
NT_167246.2   g.2879572T>C
NT_167246.1   g.2885192T>C
NT_167249.2   g.2873811T>C
NT_167249.1   g.2873109T>C
NT  

rs1799724

Strand:    Allele origin:   Allele change:   Mutation type: snv

NC_000006.12   g.31574705C>T
NC_000006.11   g.31542482C>T
NG_007462.1   g.4133C>T
NG_012010.1   g.7607C>T
NT_113891.3   g.3051992C>T
NT_113891.2   g.3052098C>T
NT_167246.2   g.2879746C>T
NT_167246.1   g.2885366C>T
NT_167249.2   g.2873985C>T
NT_167249.1   g.2873283C>T
NT  

rs1800750

Strand:    Allele origin:   Allele change:   Mutation type: snv

NC_000006.12   g.31575186G>A
NC_000006.11   g.31542963G>A
NG_007462.1   g.4614G>A
NG_012010.1   g.8088G>A
NT_113891.3   g.3052473G>A
NT_113891.2   g.3052579G>A
NT_167246.2   g.2880227G>A
NT_167246.1   g.2885847G>A
NT_167249.2   g.2874466G>A
NT_167249.1   g.2873764G>A
NT  

rs361525

Strand:    Allele origin:   Allele change:   Mutation type: snv

NC_000006.12   g.31575324G>A
NC_000006.11   g.31543101G>A
NG_007462.1   g.4752G>A
NG_012010.1   g.8226G>A
NT_113891.3   g.3052611G>A
NT_113891.2   g.3052717G>A
NT_167246.2   g.2880365G>A
NT_167246.1   g.2885985G>A
NT_167249.2   g.2874604G>A
NT_167249.1   g.2873902G>A
NT  

rs632148

Strand:    Allele origin:   Allele change:   Mutation type: snv

NC_000002.12   g.31580962C>G
NC_000002.11   g.31806031C>G
NG_008365.1   g.5010G>C
NM_000348.3   c.-62G>C|SEQ=[C/G]|GENE=SRD5A2

rs2300701

Strand:    Allele origin:   Allele change:   Mutation type: snv

NC_000002.12   g.31561938A>G
NC_000002.11   g.31787008A>G
NG_008365.1   g.24034T>C|SEQ=[A/G]|GENE=SRD5A2

rs2268797

Strand:    Allele origin:   Allele change:   Mutation type: snv

NC_000002.12   g.31558682C>T
NC_000002.11   g.31783752C>T
NG_008365.1   g.27290G>A
XM_011533069.2   c.-171G>A|SEQ=[C/T]|GENE=SRD5A2

rs12470143

Strand:    Allele origin:   Allele change:   Mutation type: snv

NC_000002.12   g.31538488C>T
NC_000002.11   g.31763558C>T
NG_008365.1   g.47484G>A|SEQ=[C/T]|GENE=SRD5A2

rs5764698

Strand:    Allele origin:   Allele change:   Mutation type: snv

NC_000022.11   g.45354103G>C
NC_000022.11   g.45354103G>T
NC_000022.10   g.45749983G>C
NC_000022.10   g.45749983G>T
NM_148674.5   c.3148C>G
NM_148674.5   c.3148C>A
NM_148674.4   c.3148C>G
NM_148674.4   c.3148C>A
NM_148674.3   c.3148C>G
NM_148674.3   c.3148C>A
XR_244368.  

Protein Summary

• Protein general information: P63261  
  • Name: Actin, cytoplasmic 2 (Gamma actin) [Cleaved into: Actin, cytoplasmic 2, N terminally processed]
  • Length: 375  
  • Mass: 41793
• Sequence:

  MEEEIAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGI
  VTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTG
  IVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQ
  EMATAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESCGIHETTFNSIMKCDVDIRKDLYANTVLS
  GGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF

• Structural information:
  • Interpro: IPR004000  IPR020902  IPR004001  
  • Prosite: PS00406 PS00432 PS01132
  • PDB: 5JLH 6CXI 6CXJ 6G2T
  • PDBsum: 5JLH 6CXI 6CXJ 6G2T
  • STRING: ENSP00000458162
• Other Databases: GeneCards:  ACTG1  Malacards:  ACTG1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0043296	apical junction complex	IDA	cellular component
GO:0005911	cell-cell junction	IDA	cellular component
GO:0120192	tight junction assembly	IMP	biological process
GO:0035633	maintenance of blood-brain barrier	NAS	biological process
GO:0010628	positive regulation of gene expression	IMP	biological process
GO:0150111	regulation of transepithelial transport	IMP	biological process
GO:0001525	angiogenesis	IMP	biological process positive effect
GO:0001738	morphogenesis of a polarized epithelium	IMP	biological process
GO:1902396	protein localization to bicellular tight junction	IMP	biological process
GO:0051492	regulation of stress fiber assembly	IMP	biological process
GO:0030335	positive regulation of cell migration	IMP	biological process
GO:0090303	positive regulation of wound healing	IMP	biological process
GO:0051893	regulation of focal adhesion assembly	IMP	biological process
GO:0031625	ubiquitin protein ligase binding	IPI	molecular function
GO:0005884	actin filament	IBA	cellular component
GO:0098973	structural constituent of postsynaptic actin cytoskeleton	IBA	molecular function
GO:0005884	actin filament	IDA	cellular component
GO:0005522	profilin binding	IDA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0000166	nucleotide binding	IEA	molecular function
GO:0005856	cytoskeleton	IEA	cellular component
GO:0005524	ATP binding	IEA	molecular function
GO:0097433	dense body	ISS	cellular component
GO:0005886	plasma membrane	ISS	cellular component
GO:0005856	cytoskeleton	ISS	cellular component
GO:0005925	focal adhesion	ISS	cellular component
GO:0005886	plasma membrane	ISS	cellular component
GO:0005886	plasma membrane	ISS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0034329	cell junction assembly	TAS	biological process
GO:0038096	Fc-gamma receptor signaling pathway involved in phagocytosis	TAS	biological process
GO:0048013	ephrin receptor signaling pathway	TAS	biological process
GO:0061024	membrane organization	TAS	biological process
GO:0042802	identical protein binding	IPI	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0098685	Schaffer collateral - CA1 synapse	IEA	cellular component
GO:0071346	cellular response to interferon-gamma	IEA	biological process
GO:0015629	actin cytoskeleton	IEA	cellular component
GO:0048488	synaptic vesicle endocytosis	IEA	biological process
GO:0045335	phagocytic vesicle	IEA	cellular component
GO:0045214	sarcomere organization	IEA	biological process
GO:0044305	calyx of Held	IEA	cellular component
GO:0031941	filamentous actin	IEA	cellular component
GO:0030016	myofibril	IEA	cellular component
GO:0005200	structural constituent of cytoskeleton	IEA	molecular function
GO:0005856	cytoskeleton	IEA	cellular component
GO:0098974	postsynaptic actin cytoskeleton organization	IEA	biological process
GO:0070062	extracellular exosome	IDA	cellular component
GO:0001895	retina homeostasis	HEP	biological process
GO:0005200	structural constituent of cytoskeleton	IC	molecular function
GO:0070062	extracellular exosome	HDA	cellular component
GO:0005615	extracellular space	HDA	cellular component
GO:0005615	extracellular space	HDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0005856	cytoskeleton	TAS	cellular component
GO:0072562	blood microparticle	HDA	cellular component
GO:0005634	nucleus	HDA	cellular component
GO:0070527	platelet aggregation	HMP	biological process
GO:0016020	membrane	HDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04714	Thermogenesis
hsa05131	Shigellosis
hsa04810	Regulation of actin cytoskeleton
hsa05132	Salmonella infection
hsa04015	Rap1 signaling pathway
hsa04510	Focal adhesion
hsa05130	Pathogenic Escherichia coli infection
hsa05205	Proteoglycans in cancer
hsa04530	Tight junction
hsa04390	Hippo signaling pathway
hsa05225	Hepatocellular carcinoma
hsa04145	Phagosome
hsa04921	Oxytocin signaling pathway
hsa05164	Influenza A
hsa05418	Fluid shear stress and atherosclerosis
hsa05135	Yersinia infection
hsa04611	Platelet activation
hsa04210	Apoptosis
hsa04670	Leukocyte transendothelial migration
hsa04919	Thyroid hormone signaling pathway
hsa05414	Dilated cardiomyopathy
hsa05410	Hypertrophic cardiomyopathy
hsa05412	Arrhythmogenic right ventricular cardiomyopathy
hsa05100	Bacterial invasion of epithelial cells
hsa04971	Gastric acid secretion
hsa04520	Adherens junction
hsa05110	Vibrio cholerae infection
hsa05416	Viral myocarditis

Diseases

Associated diseases	References
Deafness, autosomal dominant	KEGG:H00604
Bilateral sudden sensorineural hearing loss	KEGG:H01705
Baraitser-Winter syndrome	KEGG:H02023
Deafness, autosomal dominant	KEGG:H00604
Bilateral sudden sensorineural hearing loss	KEGG:H01705
Baraitser-Winter syndrome	KEGG:H02023
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881