• Gene id: 7099

Gene Summary

• Gene Symbol: TLR4   Gene   UCSC   Ensembl
• Aliases: ARMD10, CD284, TLR-4, TOLL
• Gene name: toll like receptor 4
• Alternate names: toll-like receptor 4, hToll, homolog of Drosophila toll,
• Gene location: 9q33.1 (117704174: 117717490)     Exons: 4     NC_000009.12
• Gene summary(Entrez): The protein encoded by this gene is a member of the Toll-like receptor (TLR) family which plays a fundamental role in pathogen recognition and activation of innate immunity. TLRs are highly conserved from Drosophila to humans and share structural and func
• OMIM: 603030

Protein Summary

• Protein general information: O00206  
  • Name: Toll like receptor 4 (hToll) (CD antigen CD284)
  • Length: 839  
  • Mass: 95,680
• Sequence:

  MMSASRLAGTLIPAMAFLSCVRPESWEPCVEVVPNITYQCMELNFYKIPDNLPFSTKNLDLSFNPLRHLGSYSFF
  SFPELQVLDLSRCEIQTIEDGAYQSLSHLSTLILTGNPIQSLALGAFSGLSSLQKLVAVETNLASLENFPIGHLK
  TLKELNVAHNLIQSFKLPEYFSNLTNLEHLDLSSNKIQSIYCTDLRVLHQMPLLNLSLDLSLNPMNFIQPGAFKE
  IRLHKLTLRNNFDSLNVMKTCIQGLAGLEVHRLVLGEFRNEGNLEKFDKSALEGLCNLTIEEFRLAYLDYYLDDI
  IDLFNCLTNVSSFSLVSVTIERVKDFSYNFGWQHLELVNCKFGQFPTLKLKSLKRLTFTSNKGGNAFSEVDLPSL
  EFLDLSRNGLSFKGCCSQSDFGTTSLKYLDLSFNGVITMSSNFLGLEQLEHLDFQHSNLKQMSEFSVFLSLRNLI
  YLDISHTHTRVAFNGIFNGLSSLEVLKMAGNSFQENFLPDIFTELRNLTFLDLSQCQLEQLSPTAFNSLSSLQVL
  NMSHNNFFSLDTFPYKCLNSLQVLDYSLNHIMTSKKQELQHFPSSLAFLNLTQNDFACTCEHQSFLQWIKDQRQL
  LVEVERMECATPSDKQGMPVLSLNITCQMNKTIIGVSVLSVLVVSVVAVLVYKFYFHLMLLAGCIKYGRGENIYD
  AFVIYSSQDEDWVRNELVKNLEEGVPPFQLCLHYRDFIPGVAIAANIIHEGFHKSRKVIVVVSQHFIQSRWCIFE
  YEIAQTWQFLSSRAGIIFIVLQKVEKTLLRQQVELYRLLSRNTYLEWEDSVLGRHIFWRRLRKALLDGKSWNPEG
  TVGTGCNWQEATSI

• Structural information:
  • Protein Domains: LRRCT (579-629)
    TIR. (672-818)
  • Interpro: IPR000483  IPR001611  IPR003591  IPR032675  IPR000157   IPR027168  IPR035897  
  • Prosite: PS51450 PS50104
  • PDB: 2Z62 2Z63 2Z65 2Z66 3FXI 3UL7 3UL8 3UL9 3ULA 4G8A 5NAM
  • PDBsum: 2Z62 2Z63 2Z65 2Z66 3FXI 3UL7 3UL8 3UL9 3ULA 4G8A 5NAM
  • DIP: 34769
  • STRING: ENSP00000363089
• Other Databases: GeneCards:  TLR4  Malacards:  TLR4

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000187	activation of MAPK activity	ISS	biological process
GO:0001530	lipopolysaccharide binding	NAS	molecular function
GO:0001530	lipopolysaccharide binding	IMP	molecular function
GO:0001875	lipopolysaccharide receptor activity	IDA	molecular function
GO:0002224	toll-like receptor signaling pathway	IBA	biological process
GO:0002322	B cell proliferation involved in immune response	IEA	biological process
GO:0002537	nitric oxide production involved in inflammatory response	IEA	biological process
GO:0002730	regulation of dendritic cell cytokine production	IEA	biological process
GO:0002755	MyD88-dependent toll-like receptor signaling pathway	TAS	biological process
GO:0002756	MyD88-independent toll-like receptor signaling pathway	TAS	biological process
GO:0004872	receptor activity	TAS	molecular function
GO:0004888	transmembrane signaling receptor activity	NAS	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005737	cytoplasm	IDA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005887	integral component of plasma membrane	IDA	cellular component
GO:0006954	inflammatory response	IBA	biological process
GO:0006955	immune response	TAS	biological process
GO:0007249	I-kappaB kinase/NF-kappaB signaling	TAS	biological process
GO:0007252	I-kappaB phosphorylation	IDA	biological process
GO:0009897	external side of plasma membrane	IDA	cellular component
GO:0009986	cell surface	IDA	cellular component
GO:0010008	endosome membrane	TAS	cellular component
GO:0010008	endosome membrane	TAS	cellular component
GO:0010008	endosome membrane	TAS	cellular component
GO:0010008	endosome membrane	TAS	cellular component
GO:0010008	endosome membrane	TAS	cellular component
GO:0010008	endosome membrane	TAS	cellular component
GO:0010008	endosome membrane	TAS	cellular component
GO:0010008	endosome membrane	TAS	cellular component
GO:0010008	endosome membrane	TAS	cellular component
GO:0010008	endosome membrane	TAS	cellular component
GO:0010008	endosome membrane	TAS	cellular component
GO:0010008	endosome membrane	TAS	cellular component
GO:0010008	endosome membrane	TAS	cellular component
GO:0010008	endosome membrane	TAS	cellular component
GO:0010008	endosome membrane	TAS	cellular component
GO:0010008	endosome membrane	TAS	cellular component
GO:0010008	endosome membrane	TAS	cellular component
GO:0010008	endosome membrane	TAS	cellular component
GO:0010008	endosome membrane	TAS	cellular component
GO:0010008	endosome membrane	TAS	cellular component
GO:0010008	endosome membrane	TAS	cellular component
GO:0010008	endosome membrane	TAS	cellular component
GO:0010572	positive regulation of platelet activation	ISS	biological process
GO:0010628	positive regulation of gene expression	IMP	biological process
GO:0014002	astrocyte development	IEA	biological process
GO:0016046	detection of fungus	NAS	biological process
GO:0030890	positive regulation of B cell proliferation	IEA	biological process
GO:0031226	intrinsic component of plasma membrane	IDA	cellular component
GO:0031663	lipopolysaccharide-mediated signaling pathway	IGI	biological process
GO:0032496	response to lipopolysaccharide	IDA	biological process
GO:0032496	response to lipopolysaccharide	IC	biological process
GO:0032497	detection of lipopolysaccharide	IDA	biological process
GO:0032609	interferon-gamma production	IEA	biological process
GO:0032689	negative regulation of interferon-gamma production	ISS	biological process
GO:0032700	negative regulation of interleukin-17 production	ISS	biological process
GO:0032707	negative regulation of interleukin-23 production	ISS	biological process
GO:0032715	negative regulation of interleukin-6 production	ISS	biological process
GO:0032720	negative regulation of tumor necrosis factor production	ISS	biological process
GO:0032722	positive regulation of chemokine production	IDA	biological process
GO:0032727	positive regulation of interferon-alpha production	ISS	biological process
GO:0032728	positive regulation of interferon-beta production	ISS	biological process
GO:0032729	positive regulation of interferon-gamma production	ISS	biological process
GO:0032732	positive regulation of interleukin-1 production	ISS	biological process
GO:0032733	positive regulation of interleukin-10 production	ISS	biological process
GO:0032735	positive regulation of interleukin-12 production	ISS	biological process
GO:0032755	positive regulation of interleukin-6 production	IDA	biological process
GO:0032757	positive regulation of interleukin-8 production	IDA	biological process
GO:0032760	positive regulation of tumor necrosis factor production	ISS	biological process
GO:0034128	negative regulation of MyD88-independent toll-like receptor signaling pathway	TAS	biological process
GO:0034142	toll-like receptor 4 signaling pathway	TAS	biological process
GO:0035666	TRIF-dependent toll-like receptor signaling pathway	TAS	biological process
GO:0035666	TRIF-dependent toll-like receptor signaling pathway	TAS	biological process
GO:0042088	T-helper 1 type immune response	NAS	biological process
GO:0042116	macrophage activation	IMP	biological process
GO:0042346	positive regulation of NF-kappaB import into nucleus	IDA	biological process
GO:0042535	positive regulation of tumor necrosis factor biosynthetic process	IDA	biological process
GO:0042742	defense response to bacterium	TAS	biological process
GO:0045084	positive regulation of interleukin-12 biosynthetic process	IDA	biological process
GO:0045087	innate immune response	TAS	biological process
GO:0045348	positive regulation of MHC class II biosynthetic process	IEA	biological process
GO:0045359	positive regulation of interferon-beta biosynthetic process	IEA	biological process
GO:0045416	positive regulation of interleukin-8 biosynthetic process	IDA	biological process
GO:0045429	positive regulation of nitric oxide biosynthetic process	IEA	biological process
GO:0045671	negative regulation of osteoclast differentiation	NAS	biological process
GO:0045944	positive regulation of transcription from RNA polymerase II promoter	ISS	biological process
GO:0046330	positive regulation of JNK cascade	IEA	biological process
GO:0046696	lipopolysaccharide receptor complex	IDA	cellular component
GO:0046696	lipopolysaccharide receptor complex	IDA	cellular component
GO:0048471	perinuclear region of cytoplasm	IDA	cellular component
GO:0050702	interleukin-1 beta secretion	ISS	biological process
GO:0050707	regulation of cytokine secretion	IEA	biological process
GO:0050729	positive regulation of inflammatory response	IC	biological process
GO:0050829	defense response to Gram-negative bacterium	IBA	biological process
GO:0050829	defense response to Gram-negative bacterium	IC	biological process
GO:0051092	positive regulation of NF-kappaB transcription factor activity	IDA	biological process
GO:0051770	positive regulation of nitric-oxide synthase biosynthetic process	ISS	biological process
GO:0060729	intestinal epithelial structure maintenance	ISS	biological process
GO:0060907	positive regulation of macrophage cytokine production	IEA	biological process
GO:0070266	necroptotic process	TAS	biological process
GO:0070373	negative regulation of ERK1 and ERK2 cascade	ISS	biological process
GO:0070374	positive regulation of ERK1 and ERK2 cascade	IEA	biological process
GO:0070430	positive regulation of nucleotide-binding oligomerization domain containing 1 signaling pathway	IEA	biological process
GO:0070434	positive regulation of nucleotide-binding oligomerization domain containing 2 signaling pathway	IEA	biological process
GO:0071222	cellular response to lipopolysaccharide	ISS	biological process
GO:0071223	cellular response to lipoteichoic acid	IEA	biological process
GO:0071260	cellular response to mechanical stimulus	IEP	biological process
GO:0097190	apoptotic signaling pathway	TAS	biological process
GO:1900227	positive regulation of NLRP3 inflammasome complex assembly	ISS	biological process
GO:0031663	lipopolysaccharide-mediated signaling pathway	IDA	biological process
GO:0000187	activation of MAPK activity	IEA	biological process
GO:0000187	activation of MAPK activity	ISS	biological process
GO:0001530	lipopolysaccharide binding	NAS	molecular function
GO:0001530	lipopolysaccharide binding	IMP	molecular function
GO:0001875	lipopolysaccharide receptor activity	IDA	molecular function
GO:0002218	activation of innate immune response	IEA	biological process
GO:0002224	toll-like receptor signaling pathway	IBA	biological process
GO:0002322	B cell proliferation involved in immune response	IEA	biological process
GO:0002376	immune system process	IEA	biological process
GO:0002537	nitric oxide production involved in inflammatory response	IEA	biological process
GO:0002730	regulation of dendritic cell cytokine production	IEA	biological process
GO:0002755	MyD88-dependent toll-like receptor signaling pathway	IEA	biological process
GO:0002755	MyD88-dependent toll-like receptor signaling pathway	TAS	biological process
GO:0002756	MyD88-independent toll-like receptor signaling pathway	TAS	biological process
GO:0004872	receptor activity	TAS	molecular function
GO:0004888	transmembrane signaling receptor activity	IEA	molecular function
GO:0004888	transmembrane signaling receptor activity	NAS	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005737	cytoplasm	IDA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005887	integral component of plasma membrane	IDA	cellular component
GO:0006954	inflammatory response	IBA	biological process
GO:0006954	inflammatory response	IEA	biological process
GO:0006955	immune response	TAS	biological process
GO:0007165	signal transduction	IEA	biological process
GO:0007249	I-kappaB kinase/NF-kappaB signaling	TAS	biological process
GO:0007252	I-kappaB phosphorylation	IEA	biological process
GO:0007252	I-kappaB phosphorylation	IDA	biological process
GO:0009617	response to bacterium	IEA	biological process
GO:0009897	external side of plasma membrane	IDA	cellular component
GO:0009986	cell surface	IDA	cellular component
GO:0010008	endosome membrane	TAS	cellular component
GO:0010008	endosome membrane	TAS	cellular component
GO:0010008	endosome membrane	TAS	cellular component
GO:0010008	endosome membrane	TAS	cellular component
GO:0010008	endosome membrane	TAS	cellular component
GO:0010008	endosome membrane	TAS	cellular component
GO:0010008	endosome membrane	TAS	cellular component
GO:0010008	endosome membrane	TAS	cellular component
GO:0010008	endosome membrane	TAS	cellular component
GO:0010008	endosome membrane	TAS	cellular component
GO:0010008	endosome membrane	TAS	cellular component
GO:0010008	endosome membrane	TAS	cellular component
GO:0010008	endosome membrane	TAS	cellular component
GO:0010008	endosome membrane	TAS	cellular component
GO:0010008	endosome membrane	TAS	cellular component
GO:0010008	endosome membrane	TAS	cellular component
GO:0010008	endosome membrane	TAS	cellular component
GO:0010008	endosome membrane	TAS	cellular component
GO:0010008	endosome membrane	TAS	cellular component
GO:0010008	endosome membrane	TAS	cellular component
GO:0010008	endosome membrane	TAS	cellular component
GO:0010008	endosome membrane	TAS	cellular component
GO:0010572	positive regulation of platelet activation	IEA	biological process
GO:0010572	positive regulation of platelet activation	ISS	biological process
GO:0010628	positive regulation of gene expression	IMP	biological process
GO:0014002	astrocyte development	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016046	detection of fungus	NAS	biological process
GO:0030890	positive regulation of B cell proliferation	IEA	biological process
GO:0031226	intrinsic component of plasma membrane	IDA	cellular component
GO:0031663	lipopolysaccharide-mediated signaling pathway	IGI	biological process
GO:0032496	response to lipopolysaccharide	IEA	biological process
GO:0032496	response to lipopolysaccharide	IDA	biological process
GO:0032496	response to lipopolysaccharide	IC	biological process
GO:0032497	detection of lipopolysaccharide	IDA	biological process
GO:0032609	interferon-gamma production	IEA	biological process
GO:0032689	negative regulation of interferon-gamma production	IEA	biological process
GO:0032689	negative regulation of interferon-gamma production	ISS	biological process
GO:0032700	negative regulation of interleukin-17 production	IEA	biological process
GO:0032700	negative regulation of interleukin-17 production	ISS	biological process
GO:0032707	negative regulation of interleukin-23 production	IEA	biological process
GO:0032707	negative regulation of interleukin-23 production	ISS	biological process
GO:0032715	negative regulation of interleukin-6 production	IEA	biological process
GO:0032715	negative regulation of interleukin-6 production	ISS	biological process
GO:0032720	negative regulation of tumor necrosis factor production	IEA	biological process
GO:0032720	negative regulation of tumor necrosis factor production	ISS	biological process
GO:0032722	positive regulation of chemokine production	IEA	biological process
GO:0032722	positive regulation of chemokine production	IDA	biological process
GO:0032727	positive regulation of interferon-alpha production	IEA	biological process
GO:0032727	positive regulation of interferon-alpha production	ISS	biological process
GO:0032728	positive regulation of interferon-beta production	IEA	biological process
GO:0032728	positive regulation of interferon-beta production	ISS	biological process
GO:0032729	positive regulation of interferon-gamma production	IEA	biological process
GO:0032729	positive regulation of interferon-gamma production	ISS	biological process
GO:0032732	positive regulation of interleukin-1 production	IEA	biological process
GO:0032732	positive regulation of interleukin-1 production	ISS	biological process
GO:0032733	positive regulation of interleukin-10 production	IEA	biological process
GO:0032733	positive regulation of interleukin-10 production	ISS	biological process
GO:0032735	positive regulation of interleukin-12 production	IEA	biological process
GO:0032735	positive regulation of interleukin-12 production	ISS	biological process
GO:0032755	positive regulation of interleukin-6 production	IEA	biological process
GO:0032755	positive regulation of interleukin-6 production	IDA	biological process
GO:0032757	positive regulation of interleukin-8 production	IDA	biological process
GO:0032760	positive regulation of tumor necrosis factor production	IEA	biological process
GO:0032760	positive regulation of tumor necrosis factor production	ISS	biological process
GO:0032874	positive regulation of stress-activated MAPK cascade	IEA	biological process
GO:0034128	negative regulation of MyD88-independent toll-like receptor signaling pathway	TAS	biological process
GO:0034142	toll-like receptor 4 signaling pathway	IEA	biological process
GO:0034142	toll-like receptor 4 signaling pathway	TAS	biological process
GO:0035666	TRIF-dependent toll-like receptor signaling pathway	TAS	biological process
GO:0035666	TRIF-dependent toll-like receptor signaling pathway	TAS	biological process
GO:0042088	T-helper 1 type immune response	NAS	biological process
GO:0042116	macrophage activation	IEA	biological process
GO:0042116	macrophage activation	IMP	biological process
GO:0042346	positive regulation of NF-kappaB import into nucleus	IDA	biological process
GO:0042535	positive regulation of tumor necrosis factor biosynthetic process	IDA	biological process
GO:0042742	defense response to bacterium	TAS	biological process
GO:0043123	positive regulation of I-kappaB kinase/NF-kappaB signaling	IEA	biological process
GO:0045084	positive regulation of interleukin-12 biosynthetic process	IDA	biological process
GO:0045087	innate immune response	IEA	biological process
GO:0045087	innate immune response	IEA	biological process
GO:0045087	innate immune response	TAS	biological process
GO:0045348	positive regulation of MHC class II biosynthetic process	IEA	biological process
GO:0045359	positive regulation of interferon-beta biosynthetic process	IEA	biological process
GO:0045416	positive regulation of interleukin-8 biosynthetic process	IDA	biological process
GO:0045429	positive regulation of nitric oxide biosynthetic process	IEA	biological process
GO:0045671	negative regulation of osteoclast differentiation	NAS	biological process
GO:0045944	positive regulation of transcription from RNA polymerase II promoter	IEA	biological process
GO:0045944	positive regulation of transcription from RNA polymerase II promoter	ISS	biological process
GO:0046330	positive regulation of JNK cascade	IEA	biological process
GO:0046696	lipopolysaccharide receptor complex	IEA	cellular component
GO:0046696	lipopolysaccharide receptor complex	IDA	cellular component
GO:0046696	lipopolysaccharide receptor complex	IDA	cellular component
GO:0048471	perinuclear region of cytoplasm	IDA	cellular component
GO:0050671	positive regulation of lymphocyte proliferation	IEA	biological process
GO:0050702	interleukin-1 beta secretion	IEA	biological process
GO:0050702	interleukin-1 beta secretion	ISS	biological process
GO:0050707	regulation of cytokine secretion	IEA	biological process
GO:0050727	regulation of inflammatory response	IEA	biological process
GO:0050729	positive regulation of inflammatory response	IC	biological process
GO:0050829	defense response to Gram-negative bacterium	IEA	biological process
GO:0050829	defense response to Gram-negative bacterium	IEA	biological process
GO:0050829	defense response to Gram-negative bacterium	IBA	biological process
GO:0050829	defense response to Gram-negative bacterium	IC	biological process
GO:0051092	positive regulation of NF-kappaB transcription factor activity	IDA	biological process
GO:0051770	positive regulation of nitric-oxide synthase biosynthetic process	IEA	biological process
GO:0051770	positive regulation of nitric-oxide synthase biosynthetic process	ISS	biological process
GO:0060729	intestinal epithelial structure maintenance	IEA	biological process
GO:0060729	intestinal epithelial structure maintenance	ISS	biological process
GO:0060907	positive regulation of macrophage cytokine production	IEA	biological process
GO:0070266	necroptotic process	TAS	biological process
GO:0070373	negative regulation of ERK1 and ERK2 cascade	IEA	biological process
GO:0070373	negative regulation of ERK1 and ERK2 cascade	ISS	biological process
GO:0070374	positive regulation of ERK1 and ERK2 cascade	IEA	biological process
GO:0070430	positive regulation of nucleotide-binding oligomerization domain containing 1 signaling pathway	IEA	biological process
GO:0070434	positive regulation of nucleotide-binding oligomerization domain containing 2 signaling pathway	IEA	biological process
GO:0071222	cellular response to lipopolysaccharide	IEA	biological process
GO:0071222	cellular response to lipopolysaccharide	ISS	biological process
GO:0071223	cellular response to lipoteichoic acid	IEA	biological process
GO:0071260	cellular response to mechanical stimulus	IEP	biological process
GO:0097190	apoptotic signaling pathway	TAS	biological process
GO:1900227	positive regulation of NLRP3 inflammasome complex assembly	IEA	biological process
GO:1900227	positive regulation of NLRP3 inflammasome complex assembly	ISS	biological process
GO:0031663	lipopolysaccharide-mediated signaling pathway	IDA	biological process
GO:0000187	activation of MAPK activity	ISS	biological process
GO:0001530	lipopolysaccharide binding	NAS	molecular function
GO:0001530	lipopolysaccharide binding	IMP	molecular function
GO:0001875	lipopolysaccharide receptor activity	IDA	molecular function
GO:0002224	toll-like receptor signaling pathway	IBA	biological process
GO:0002755	MyD88-dependent toll-like receptor signaling pathway	TAS	biological process
GO:0002756	MyD88-independent toll-like receptor signaling pathway	TAS	biological process
GO:0004872	receptor activity	TAS	molecular function
GO:0004888	transmembrane signaling receptor activity	NAS	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005737	cytoplasm	IDA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005887	integral component of plasma membrane	IDA	cellular component
GO:0006954	inflammatory response	IBA	biological process
GO:0006955	immune response	TAS	biological process
GO:0007249	I-kappaB kinase/NF-kappaB signaling	TAS	biological process
GO:0007252	I-kappaB phosphorylation	IDA	biological process
GO:0009897	external side of plasma membrane	IDA	cellular component
GO:0009986	cell surface	IDA	cellular component
GO:0010008	endosome membrane	TAS	cellular component
GO:0010008	endosome membrane	TAS	cellular component
GO:0010008	endosome membrane	TAS	cellular component
GO:0010008	endosome membrane	TAS	cellular component
GO:0010008	endosome membrane	TAS	cellular component
GO:0010008	endosome membrane	TAS	cellular component
GO:0010008	endosome membrane	TAS	cellular component
GO:0010008	endosome membrane	TAS	cellular component
GO:0010008	endosome membrane	TAS	cellular component
GO:0010008	endosome membrane	TAS	cellular component
GO:0010008	endosome membrane	TAS	cellular component
GO:0010008	endosome membrane	TAS	cellular component
GO:0010008	endosome membrane	TAS	cellular component
GO:0010008	endosome membrane	TAS	cellular component
GO:0010008	endosome membrane	TAS	cellular component
GO:0010008	endosome membrane	TAS	cellular component
GO:0010008	endosome membrane	TAS	cellular component
GO:0010008	endosome membrane	TAS	cellular component
GO:0010008	endosome membrane	TAS	cellular component
GO:0010008	endosome membrane	TAS	cellular component
GO:0010008	endosome membrane	TAS	cellular component
GO:0010008	endosome membrane	TAS	cellular component
GO:0010572	positive regulation of platelet activation	ISS	biological process
GO:0010628	positive regulation of gene expression	IMP	biological process
GO:0016046	detection of fungus	NAS	biological process
GO:0031226	intrinsic component of plasma membrane	IDA	cellular component
GO:0031663	lipopolysaccharide-mediated signaling pathway	IGI	biological process
GO:0032496	response to lipopolysaccharide	IDA	biological process
GO:0032496	response to lipopolysaccharide	IC	biological process
GO:0032497	detection of lipopolysaccharide	IDA	biological process
GO:0032689	negative regulation of interferon-gamma production	ISS	biological process
GO:0032700	negative regulation of interleukin-17 production	ISS	biological process
GO:0032707	negative regulation of interleukin-23 production	ISS	biological process
GO:0032715	negative regulation of interleukin-6 production	ISS	biological process
GO:0032720	negative regulation of tumor necrosis factor production	ISS	biological process
GO:0032722	positive regulation of chemokine production	IDA	biological process
GO:0032727	positive regulation of interferon-alpha production	ISS	biological process
GO:0032728	positive regulation of interferon-beta production	ISS	biological process
GO:0032729	positive regulation of interferon-gamma production	ISS	biological process
GO:0032732	positive regulation of interleukin-1 production	ISS	biological process
GO:0032733	positive regulation of interleukin-10 production	ISS	biological process
GO:0032735	positive regulation of interleukin-12 production	ISS	biological process
GO:0032755	positive regulation of interleukin-6 production	IDA	biological process
GO:0032757	positive regulation of interleukin-8 production	IDA	biological process
GO:0032760	positive regulation of tumor necrosis factor production	ISS	biological process
GO:0034128	negative regulation of MyD88-independent toll-like receptor signaling pathway	TAS	biological process
GO:0034142	toll-like receptor 4 signaling pathway	TAS	biological process
GO:0035666	TRIF-dependent toll-like receptor signaling pathway	TAS	biological process
GO:0035666	TRIF-dependent toll-like receptor signaling pathway	TAS	biological process
GO:0042088	T-helper 1 type immune response	NAS	biological process
GO:0042116	macrophage activation	IMP	biological process
GO:0042346	positive regulation of NF-kappaB import into nucleus	IDA	biological process
GO:0042535	positive regulation of tumor necrosis factor biosynthetic process	IDA	biological process
GO:0042742	defense response to bacterium	TAS	biological process
GO:0045084	positive regulation of interleukin-12 biosynthetic process	IDA	biological process
GO:0045087	innate immune response	TAS	biological process
GO:0045416	positive regulation of interleukin-8 biosynthetic process	IDA	biological process
GO:0045671	negative regulation of osteoclast differentiation	NAS	biological process
GO:0045944	positive regulation of transcription from RNA polymerase II promoter	ISS	biological process
GO:0046696	lipopolysaccharide receptor complex	IDA	cellular component
GO:0046696	lipopolysaccharide receptor complex	IDA	cellular component
GO:0048471	perinuclear region of cytoplasm	IDA	cellular component
GO:0050702	interleukin-1 beta secretion	ISS	biological process
GO:0050729	positive regulation of inflammatory response	IC	biological process
GO:0050829	defense response to Gram-negative bacterium	IBA	biological process
GO:0050829	defense response to Gram-negative bacterium	IC	biological process
GO:0051092	positive regulation of NF-kappaB transcription factor activity	IDA	biological process
GO:0051770	positive regulation of nitric-oxide synthase biosynthetic process	ISS	biological process
GO:0060729	intestinal epithelial structure maintenance	ISS	biological process
GO:0070266	necroptotic process	TAS	biological process
GO:0070373	negative regulation of ERK1 and ERK2 cascade	ISS	biological process
GO:0071222	cellular response to lipopolysaccharide	ISS	biological process
GO:0071260	cellular response to mechanical stimulus	IEP	biological process
GO:0097190	apoptotic signaling pathway	TAS	biological process
GO:1900227	positive regulation of NLRP3 inflammasome complex assembly	ISS	biological process
GO:0031663	lipopolysaccharide-mediated signaling pathway	IDA	biological process

KEGG pathways

Pathway id	Pathway name
hsa04064	NF-kappa B signaling pathway
hsa04066	HIF-1 signaling pathway
hsa04151	PI3K-Akt signaling pathway
hsa04145	Phagosome
hsa04217	Necroptosis
hsa04620	Toll-like receptor signaling pathway
hsa04621	NOD-like receptor signaling pathway
hsa05205	Proteoglycans in cancer
hsa05235	PD-L1 expression and PD-1 checkpoint pathway in cancer
hsa05323	Rheumatoid arthritis
hsa05321	Inflammatory bowel disease
hsa05130	Pathogenic Escherichia coli infection
hsa05132	Salmonella infection
hsa05135	Yersinia infection
hsa05133	Pertussis
hsa05134	Legionellosis
hsa05152	Tuberculosis
hsa05170	Human immunodeficiency virus 1 infection
hsa05162	Measles
hsa05164	Influenza A
hsa05161	Hepatitis B
hsa05146	Amoebiasis
hsa05144	Malaria
hsa05145	Toxoplasmosis
hsa05140	Leishmaniasis
hsa05142	Chagas disease

Diseases

Associated diseases	References
Cancer (endometrial)	INFBASE: 18775079
Cancer	GAD: 15087412
Cancer (adenocarcinoma)	GAD: 18826495
Cancer (basal cell)	GAD: 19614650
Cancer (bladder)	GAD: 19692168
Cancer (cervical)	GAD: 19012493
Cancer (colorectal)	GAD: 16706818
Cancer (endometrial)	GAD: 20646321
Cancer (esophageal)	GAD: 17324405
Cancer (gastric)	GAD: 19191896
Cancer (glaucoma)	GAD: 18586872
Cancer (head and neck)	GAD: 20819778
Cancer (lymphoma)	GAD: 16019531
Cancer (meningeal)	GAD: 20406964
Cancer (myeloma)	GAD: 20568250
Cancer (nasopharyngeal)	GAD: 16969132
Cancer (prostate)	GAD: 15087412
Cancer (stomach)	GAD: 17086894
Cancer (breast)	GAD: 19810822
Angina pectoris	GAD: 17044867
Apoplexy	GAD: 19646345
Atherosclerosis	GAD: 15367917
Brain ischemia	GAD: 18549840
Cardiovascular disease	GAD: 15864121
Cardiovascular disease	GAD: 15864121
Carotid artery diseases	GAD: 17996871
Brain infarction	GAD: 20504212
Cystic fibrosis	GAD: 16830219
Cleft defects	GAD: 18978678
Sclerosing cholangitis	GAD: 17100974
Gastric disease	GAD: 19295440
Graves disease	GAD: 21050493
Macular degeneration	GAD: 15829498
Age-related macular degeneration	KEGG: H00821
Sarcoidosis	GAD: 16487240
Hodgkin disease	GAD: 21061265
Idiopathic thrombocytopenic purpura	GAD: 20626741
Allergy	GAD: 19763595
Ankylosing spondylitis	GAD: 15647432
Anus diseases	GAD: 18972554
Arthritis	GAD: 12846053
Asthma	GAD: 14987294
Atopy	GAD: 16142747
Autoimmune diseases	GAD: 19500628
Behcet's disease	GAD: 19796532
Chronic ulcerative colitis	GAD: 20093834
Crohn's disease	GAD: 15655821
Ulcerative colitis	GAD: 16085746
Rheumatoid arthritis	GAD: 15022344
Inflammatory bowel disease	GAD: 15905704
Periodontitis	GAD: 18983635
Multiple sclerosis	GAD: 12622779
Periodontitis	GAD: 18062119
Systemic inflammatory hyporesponsiveness	GAD: 14610481
Systemic lupus erythematosus (SLE)	GAD: 14651524
Systemic lupus erythematosus (SLE)	GAD: 14651524
Celiac disease	GAD: 20483368
Hypersensitivity	GAD: 18001295
Amyloidosis	GAD: 19445990
Metabolic syndrome	GAD: 19922963
Diabetes	GAD: 14693986
Hypercholesterolemia	GAD: 14764071
Insulin resistance	GAD: 20357716
Bone diseases	GAD: 19453261
Ankylosing spondylitis	GAD: 18034244
Cerebral arteriopathy	GAD: 15258789
Stroke	GAD: 15910856
Giant cell arteritis	GAD: 19531762
Guillain-Barre syndrome	GAD: 15081257
Alzheimer's disease	GAD: 19006850
Parkinson disease	GAD: 17052657
Epilepsy	GAD: 20807077
Cerebral palsy	GAD: 19238444
Mental disorder	GAD: 20889312
Schizophrenia	GAD: 19571808
Chronic renal failure	GAD: 21085059
Kidney diseases	GAD: 19578796
Chorioamnionitis	GAD: 18928988
Preeclampsia	GAD: 18382655
Pregnancy loss	GAD: 16982657
Premature rupture of membranes	GAD: 12397216
Preterm birth risk	GAD: 15516360
Poor ovarian response (POR)	INFBASE: 25083184
Pelvic inflammatory disease (PID)	INFBASE: 23255565
Tubal factor infertility	INFBASE: 20598754
Leukocytospermia	MIK: 26227162
Endometriosis	INFBASE: 21214494
Endometriosis-associated infertility	INFBASE: 26177128
Chronic obstructive pulmonary disease (COPD)	GAD: 20169003
Pulmonary function	GAD: 15591473
Dermatitis	GAD: 19627277
Eczema	GAD: 20646366
Connective tissue diseases	GAD: 19527514
Periodontal disease	GAD: 15341923
Albuminuria	GAD: 20146922
Atrophy	GAD: 19326213
Lipopolysaccharide hyporesponsiveness	GAD: 11835533
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Leukocytospermia	MIK: 26227162
Male infertility	MIK: 26227162

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
26227162	Leukocytospermia, idiopathic male infertility			85 (38 non-LCS patients, 47 LCS patients)	Male infertility	TLR-2/4 COX-2 and Nrf-2
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881