• Gene id: 7098

Gene Summary

• Gene Symbol: TLR3   Gene   UCSC   Ensembl
• Aliases: CD283, IIAE2
• Gene name: toll like receptor 3
• Alternate names: toll-like receptor 3,
• Gene location: 4q35.1 (186069155: 186088072)     Exons: 5     NC_000004.12
• Gene summary(Entrez): The protein encoded by this gene is a member of the Toll-like receptor (TLR) family which plays a fundamental role in pathogen recognition and activation of innate immunity. TLRs are highly conserved from Drosophila to humans and share structural and func

Protein Summary

• Protein general information: O15455  
  • Name: Toll like receptor 3 (CD antigen CD283)
  • Length: 904  
  • Mass: 103829
  • Tissue specificity: Expressed at high level in placenta and pancreas. Also detected in CD11c+ immature dendritic cells. Only expressed in dendritic cells and not in other leukocytes, including monocyte precursors. TLR3 is the TLR that is expressed most st
• Sequence:

  MRQTLPCIYFWGGLLPFGMLCASSTTKCTVSHEVADCSHLKLTQVPDDLPTNITVLNLTHNQLRRLPAANFTRYS
  QLTSLDVGFNTISKLEPELCQKLPMLKVLNLQHNELSQLSDKTFAFCTNLTELHLMSNSIQKIKNNPFVKQKNLI
  TLDLSHNGLSSTKLGTQVQLENLQELLLSNNKIQALKSEELDIFANSSLKKLELSSNQIKEFSPGCFHAIGRLFG
  LFLNNVQLGPSLTEKLCLELANTSIRNLSLSNSQLSTTSNTTFLGLKWTNLTMLDLSYNNLNVVGNDSFAWLPQL
  EYFFLEYNNIQHLFSHSLHGLFNVRYLNLKRSFTKQSISLASLPKIDDFSFQWLKCLEHLNMEDNDIPGIKSNMF
  TGLINLKYLSLSNSFTSLRTLTNETFVSLAHSPLHILNLTKNKISKIESDAFSWLGHLEVLDLGLNEIGQELTGQ
  EWRGLENIFEIYLSYNKYLQLTRNSFALVPSLQRLMLRRVALKNVDSSPSPFQPLRNLTILDLSNNNIANINDDM
  LEGLEKLEILDLQHNNLARLWKHANPGGPIYFLKGLSHLHILNLESNGFDEIPVEVFKDLFELKIIDLGLNNLNT
  LPASVFNNQVSLKSLNLQKNLITSVEKKVFGPAFRNLTELDMRFNPFDCTCESIAWFVNWINETHTNIPELSSHY
  LCNTPPHYHGFPVRLFDTSSCKDSAPFELFFMINTSILLIFIFIVLLIHFEGWRISFYWNVSVHRVLGFKEIDRQ
  TEQFEYAAYIIHAYKDKDWVWEHFSSMEKEDQSLKFCLEERDFEAGVFELEAIVNSIKRSRKIIFVITHHLLKDP
  LCKRFKVHHAVQQAIEQNLDSIILVFLEEIPDYKLNHALCLRRGMFKSHCILNWPVQKERIGAFRHKLQVALGSK
  NSVH

• Structural information:
  • Protein Domains: (24..5-)
    (/note="LRRNT-)
    (645..69-)
    (/note="LRRCT-)
    (754..89-)
    (/note="TIR-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00204"-)
  • Interpro: IPR000483  IPR001611  IPR003591  IPR032675  IPR000157   IPR027173  IPR041015  IPR035897  
  • Prosite: PS51450 PS50104
  • PDB: 1ZIW 2A0Z 2MK9 2MKA 3ULU 3ULV 5GS0
  • PDBsum: 1ZIW 2A0Z 2MK9 2MKA 3ULU 3ULV 5GS0
  • DIP: 29660
  • STRING: ENSP00000296795
• Other Databases: GeneCards:  TLR3  Malacards:  TLR3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005615	extracellular space	IBA	cellular component
GO:0031012	extracellular matrix	IBA	cellular component
GO:0003725	double-stranded RNA binding	IBA	molecular function
GO:0043331	response to dsRNA	IBA	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0001819	positive regulation of cytokine production	IEA	biological process
GO:0002756	MyD88-independent toll-like receptor signaling pathway	IEA	biological process
GO:0007165	signal transduction	IEA	biological process
GO:0032722	positive regulation of chemokine production	IEA	biological process
GO:0043330	response to exogenous dsRNA	IEA	biological process
GO:0045087	innate immune response	IEA	biological process
GO:0050729	positive regulation of inflammatory response	IEA	biological process
GO:0051607	defense response to virus	IEA	biological process
GO:0002224	toll-like receptor signaling pathway	IEA	biological process
GO:0003725	double-stranded RNA binding	IEA	molecular function
GO:0004888	transmembrane signaling receptor activity	IEA	molecular function
GO:0006955	immune response	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0034138	toll-like receptor 3 signaling pathway	IEA	biological process
GO:0005768	endosome	IEA	cellular component
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0002376	immune system process	IEA	biological process
GO:0045087	innate immune response	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0003723	RNA binding	IEA	molecular function
GO:0006954	inflammatory response	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0038023	signaling receptor activity	TAS	molecular function
GO:0007165	signal transduction	TAS	biological process
GO:0007165	signal transduction	TAS	biological process
GO:0005887	integral component of plasma membrane	TAS	cellular component
GO:0042742	defense response to bacterium	TAS	biological process
GO:0043330	response to exogenous dsRNA	IDA	biological process
GO:0002224	toll-like receptor signaling pathway	TAS	biological process
GO:0007249	I-kappaB kinase/NF-kappaB signaling	TAS	biological process
GO:0010008	endosome membrane	TAS	cellular component
GO:0010008	endosome membrane	TAS	cellular component
GO:0010008	endosome membrane	TAS	cellular component
GO:0010008	endosome membrane	TAS	cellular component
GO:0010008	endosome membrane	TAS	cellular component
GO:0010008	endosome membrane	TAS	cellular component
GO:0010008	endosome membrane	TAS	cellular component
GO:0010008	endosome membrane	TAS	cellular component
GO:0010008	endosome membrane	TAS	cellular component
GO:0010008	endosome membrane	TAS	cellular component
GO:0010008	endosome membrane	TAS	cellular component
GO:0010008	endosome membrane	TAS	cellular component
GO:0010008	endosome membrane	TAS	cellular component
GO:0010008	endosome membrane	TAS	cellular component
GO:0010008	endosome membrane	TAS	cellular component
GO:0010008	endosome membrane	TAS	cellular component
GO:0010008	endosome membrane	TAS	cellular component
GO:0010008	endosome membrane	TAS	cellular component
GO:0010008	endosome membrane	TAS	cellular component
GO:0010008	endosome membrane	TAS	cellular component
GO:0010008	endosome membrane	TAS	cellular component
GO:0010008	endosome membrane	TAS	cellular component
GO:0010008	endosome membrane	TAS	cellular component
GO:0010008	endosome membrane	TAS	cellular component
GO:0010008	endosome membrane	TAS	cellular component
GO:0034138	toll-like receptor 3 signaling pathway	TAS	biological process
GO:0035666	TRIF-dependent toll-like receptor signaling pathway	TAS	biological process
GO:0000139	Golgi membrane	TAS	cellular component
GO:0000139	Golgi membrane	TAS	cellular component
GO:0002756	MyD88-independent toll-like receptor signaling pathway	TAS	biological process
GO:0005789	endoplasmic reticulum membrane	TAS	cellular component
GO:0005789	endoplasmic reticulum membrane	TAS	cellular component
GO:0005789	endoplasmic reticulum membrane	TAS	cellular component
GO:0034128	negative regulation of MyD88-independent toll-like receptor signaling pathway	TAS	biological process
GO:0036020	endolysosome membrane	TAS	cellular component
GO:0070266	necroptotic process	TAS	biological process
GO:0097190	apoptotic signaling pathway	TAS	biological process
GO:0042802	identical protein binding	IPI	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0051607	defense response to virus	IEA	biological process
GO:0051092	positive regulation of NF-kappaB transcription factor activity	IEA	biological process
GO:0045080	positive regulation of chemokine biosynthetic process	IEA	biological process
GO:0043330	response to exogenous dsRNA	IEA	biological process
GO:0043123	positive regulation of I-kappaB kinase/NF-kappaB signaling	IEA	biological process
GO:0032755	positive regulation of interleukin-6 production	IEA	biological process
GO:0009615	response to virus	IEA	biological process
GO:0006952	defense response	IEA	biological process
GO:0071346	cellular response to interferon-gamma	IEA	biological process
GO:0035690	cellular response to drug	IEA	biological process
GO:0009615	response to virus	IEA	biological process
GO:0046330	positive regulation of JNK cascade	IEA	biological process
GO:0045944	positive regulation of transcription by RNA polymerase II	IEA	biological process
GO:0045766	positive regulation of angiogenesis	IEA	biological process
GO:0034346	positive regulation of type III interferon production	IEA	biological process
GO:0032760	positive regulation of tumor necrosis factor production	IEA	biological process
GO:0032735	positive regulation of interleukin-12 production	IEA	biological process
GO:0032728	positive regulation of interferon-beta production	IEA	biological process
GO:0032481	positive regulation of type I interferon production	IEA	biological process
GO:0002730	regulation of dendritic cell cytokine production	IEA	biological process
GO:0071360	cellular response to exogenous dsRNA	IEA	biological process
GO:0043331	response to dsRNA	IEA	biological process
GO:0043065	positive regulation of apoptotic process	IEA	biological process
GO:0035458	cellular response to interferon-beta	IEA	biological process
GO:0008584	male gonad development	IEA	biological process
GO:0003725	double-stranded RNA binding	IEA	molecular function
GO:0002224	toll-like receptor signaling pathway	IEA	biological process
GO:0001774	microglial cell activation	IEA	biological process
GO:0007252	I-kappaB phosphorylation	IDA	biological process
GO:0032722	positive regulation of chemokine production	IDA	biological process
GO:0032755	positive regulation of interleukin-6 production	IDA	biological process
GO:0032757	positive regulation of interleukin-8 production	IDA	biological process
GO:0050729	positive regulation of inflammatory response	IC	biological process
GO:0005737	cytoplasm	IDA	cellular component
GO:0009986	cell surface	IDA	NOT|cellular component
GO:0034123	positive regulation of toll-like receptor signaling pathway	IDA	biological process
GO:1901224	positive regulation of NIK/NF-kappaB signaling	IDA	biological process
GO:0045087	innate immune response	TAS	biological process
GO:0051607	defense response to virus	TAS	biological process
GO:0032728	positive regulation of interferon-beta production	ISS	biological process
GO:0032735	positive regulation of interleukin-12 production	ISS	biological process
GO:0032760	positive regulation of tumor necrosis factor production	ISS	biological process
GO:0045944	positive regulation of transcription by RNA polymerase II	ISS	biological process
GO:0005789	endoplasmic reticulum membrane	IEA	cellular component
GO:0010008	endosome membrane	IEA	cellular component
GO:0005769	early endosome	IEA	cellular component
GO:0045356	positive regulation of interferon-alpha biosynthetic process	IDA	biological process
GO:0097191	extrinsic apoptotic signaling pathway	IDA	biological process
GO:0003725	double-stranded RNA binding	IDA	molecular function
GO:0045359	positive regulation of interferon-beta biosynthetic process	IDA	biological process
GO:0045078	positive regulation of interferon-gamma biosynthetic process	IDA	biological process
GO:0097527	necroptotic signaling pathway	IDA	biological process
GO:0071260	cellular response to mechanical stimulus	IEP	biological process
GO:0016020	membrane	NAS	cellular component
GO:0004888	transmembrane signaling receptor activity	NAS	molecular function
GO:0010628	positive regulation of gene expression	IMP	biological process
GO:0006972	hyperosmotic response	NAS	biological process
GO:0005765	lysosomal membrane	HDA	cellular component
GO:0009597	detection of virus	NAS	biological process
GO:0003725	double-stranded RNA binding	NAS	molecular function
GO:0010628	positive regulation of gene expression	IMP	biological process
GO:0045671	negative regulation of osteoclast differentiation	NAS	biological process
GO:0045359	positive regulation of interferon-beta biosynthetic process	IMP	biological process
GO:0007250	activation of NF-kappaB-inducing kinase activity	NAS	biological process

KEGG pathways

Pathway id	Pathway name
hsa05168	Herpes simplex virus 1 infection
hsa05165	Human papillomavirus infection
hsa05167	Kaposi sarcoma-associated herpesvirus infection
hsa04217	Necroptosis
hsa05164	Influenza A
hsa05161	Hepatitis B
hsa05160	Hepatitis C
hsa04620	Toll-like receptor signaling pathway

Diseases

Associated diseases	References
Kuhnt-Junius degeneration	PMID:23946637
Behcet's disease	PMID:23908180
Colon carcinoma	PMID:23467704
Asthma	PMID:21129050
Asthma	PMID:17434873
Eye disease	PMID:16146574
hepatocellular carcinoma	PMID:23197495
type 1 diabetes mellitus	PMID:16029432
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881