• Gene id: 7097

Gene Summary

• Gene Symbol: TLR2   Gene   UCSC   Ensembl
• Aliases: CD282, TIL4
• Gene name: toll like receptor 2
• Alternate names: toll-like receptor 2, toll/interleukin-1 receptor-like protein 4,
• Gene location: 4q31.3 (153684079: 153710642)     Exons: 5     NC_000004.12
• Gene summary(Entrez): The protein encoded by this gene is a member of the Toll-like receptor (TLR) family which plays a fundamental role in pathogen recognition and activation of innate immunity. TLRs are highly conserved from Drosophila to humans and share structural and func
• OMIM: 603028

Protein Summary

• Protein general information: O60603  
  • Name: Toll like receptor 2 (Toll/interleukin 1 receptor like protein 4) (CD antigen CD282)
  • Length: 784  
  • Mass: 89,838
• Sequence:

  MPHTLWMVWVLGVIISLSKEESSNQASLSCDRNGICKGSSGSLNSIPSGLTEAVKSLDLSNNRITYISNSDLQRC
  VNLQALVLTSNGINTIEEDSFSSLGSLEHLDLSYNYLSNLSSSWFKPLSSLTFLNLLGNPYKTLGETSLFSHLTK
  LQILRVGNMDTFTKIQRKDFAGLTFLEELEIDASDLQSYEPKSLKSIQNVSHLILHMKQHILLLEIFVDVTSSVE
  CLELRDTDLDTFHFSELSTGETNSLIKKFTFRNVKITDESLFQVMKLLNQISGLLELEFDDCTLNGVGNFRASDN
  DRVIDPGKVETLTIRRLHIPRFYLFYDLSTLYSLTERVKRITVENSKVFLVPCLLSQHLKSLEYLDLSENLMVEE
  YLKNSACEDAWPSLQTLILRQNHLASLEKTGETLLTLKNLTNIDISKNSFHSMPETCQWPEKMKYLNLSSTRIHS
  VTGCIPKTLEILDVSNNNLNLFSLNLPQLKELYISRNKLMTLPDASLLPMLLVLKISRNAITTFSKEQLDSFHTL
  KTLEAGGNNFICSCEFLSFTQEQQALAKVLIDWPANYLCDSPSHVRGQQVQDVRLSVSECHRTALVSGMCCALFL
  LILLTGVLCHRFHGLWYMKMMWAWLQAKRKPRKAPSRNICYDAFVSYSERDAYWVENLMVQELENFNPPFKLCLH
  KRDFIPGKWIIDNIIDSIEKSHKTVFVLSENFVKSEWCKYELDFSHFRLFDENNDAAILILLEPIEKKAIPQRFC
  KLRKIMNTKTYLEWPMDEAQREGFWVNLRAAIKS

• Structural information:
  • Protein Domains: LRRCT (525-579)
    TIR. (639-784)
  • Interpro: IPR000483  IPR001611  IPR003591  IPR032675  IPR000157   IPR027185  IPR035897  
  • Prosite: PS51450 PS50104
  • PDB: 1FYW 1FYX 1O77 2Z7X 2Z80
  • PDBsum: 1FYW 1FYX 1O77 2Z7X 2Z80
  • DIP: 35138
  • STRING: ENSP00000260010
• Other Databases: GeneCards:  TLR2  Malacards:  TLR2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0001530	lipopolysaccharide binding	IDA	molecular function
GO:0001875	lipopolysaccharide receptor activity	TAS	molecular function
GO:0002374	cytokine secretion involved in immune response	IMP	biological process
GO:0002755	MyD88-dependent toll-like receptor signaling pathway	TAS	biological process
GO:0004872	receptor activity	IDA	molecular function
GO:0004888	transmembrane signaling receptor activity	IEA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005737	cytoplasm	IDA	cellular component
GO:0005794	Golgi apparatus	IDA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005887	integral component of plasma membrane	TAS	cellular component
GO:0006915	apoptotic process	TAS	biological process
GO:0006954	inflammatory response	IEA	biological process
GO:0006955	immune response	TAS	biological process
GO:0007165	signal transduction	TAS	biological process
GO:0007252	I-kappaB phosphorylation	IDA	biological process
GO:0008329	signaling pattern recognition receptor activity	IDA	molecular function
GO:0009986	cell surface	IDA	cellular component
GO:0010628	positive regulation of gene expression	IMP	biological process
GO:0030177	positive regulation of Wnt signaling pathway	IMP	biological process
GO:0030670	phagocytic vesicle membrane	IEA	cellular component
GO:0031226	intrinsic component of plasma membrane	IDA	cellular component
GO:0031663	lipopolysaccharide-mediated signaling pathway	IEA	biological process
GO:0032613	interleukin-10 production	IDA	biological process
GO:0032722	positive regulation of chemokine production	IDA	biological process
GO:0032728	positive regulation of interferon-beta production	ISS	biological process
GO:0032735	positive regulation of interleukin-12 production	ISS	biological process
GO:0032741	positive regulation of interleukin-18 production	ISS	biological process
GO:0032755	positive regulation of interleukin-6 production	IDA	biological process
GO:0032757	positive regulation of interleukin-8 production	IDA	biological process
GO:0032757	positive regulation of interleukin-8 production	IDA	biological process
GO:0032760	positive regulation of tumor necrosis factor production	ISS	biological process
GO:0034123	positive regulation of toll-like receptor signaling pathway	IDA	biological process
GO:0034134	toll-like receptor 2 signaling pathway	IEA	biological process
GO:0035325	Toll-like receptor binding	IPI	molecular function
GO:0035354	Toll-like receptor 1-Toll-like receptor 2 protein complex	IDA	cellular component
GO:0038123	toll-like receptor TLR1:TLR2 signaling pathway	TAS	biological process
GO:0038124	toll-like receptor TLR6:TLR2 signaling pathway	TAS	biological process
GO:0042346	positive regulation of NF-kappaB import into nucleus	IDA	biological process
GO:0042495	detection of triacyl bacterial lipopeptide	IDA	biological process
GO:0042496	detection of diacyl bacterial lipopeptide	IDA	biological process
GO:0042497	triacyl lipopeptide binding	IDA	molecular function
GO:0042834	peptidoglycan binding	IDA	molecular function
GO:0045087	innate immune response	TAS	biological process
GO:0045121	membrane raft	IDA	cellular component
GO:0045944	positive regulation of transcription from RNA polymerase II promoter	ISS	biological process
GO:0046982	protein heterodimerization activity	IDA	molecular function
GO:0050707	regulation of cytokine secretion	IEA	biological process
GO:0050729	positive regulation of inflammatory response	IC	biological process
GO:0050830	defense response to Gram-positive bacterium	IDA	biological process
GO:0051092	positive regulation of NF-kappaB transcription factor activity	IDA	biological process
GO:0051092	positive regulation of NF-kappaB transcription factor activity	IDA	biological process
GO:0051770	positive regulation of nitric-oxide synthase biosynthetic process	ISS	biological process
GO:0071221	cellular response to bacterial lipopeptide	TAS	biological process
GO:0071223	cellular response to lipoteichoic acid	IDA	biological process
GO:0071726	cellular response to diacyl bacterial lipopeptide	IDA	biological process
GO:0071726	cellular response to diacyl bacterial lipopeptide	IDA	biological process
GO:0071727	cellular response to triacyl bacterial lipopeptide	IDA	biological process
GO:0071727	cellular response to triacyl bacterial lipopeptide	IDA	biological process
GO:0001530	lipopolysaccharide binding	IDA	molecular function
GO:0001875	lipopolysaccharide receptor activity	TAS	molecular function
GO:0002224	toll-like receptor signaling pathway	IEA	biological process
GO:0002237	response to molecule of bacterial origin	IEA	biological process
GO:0002374	cytokine secretion involved in immune response	IMP	biological process
GO:0002376	immune system process	IEA	biological process
GO:0002755	MyD88-dependent toll-like receptor signaling pathway	IEA	biological process
GO:0002755	MyD88-dependent toll-like receptor signaling pathway	TAS	biological process
GO:0004872	receptor activity	TAS	molecular function
GO:0004872	receptor activity	IDA	molecular function
GO:0004888	transmembrane signaling receptor activity	IEA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005737	cytoplasm	IDA	cellular component
GO:0005794	Golgi apparatus	IDA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005887	integral component of plasma membrane	TAS	cellular component
GO:0006915	apoptotic process	TAS	biological process
GO:0006954	inflammatory response	IEA	biological process
GO:0006954	inflammatory response	IEA	biological process
GO:0006955	immune response	IEA	biological process
GO:0006955	immune response	TAS	biological process
GO:0007165	signal transduction	IEA	biological process
GO:0007165	signal transduction	TAS	biological process
GO:0007165	signal transduction	TAS	biological process
GO:0007165	signal transduction	TAS	biological process
GO:0007252	I-kappaB phosphorylation	IDA	biological process
GO:0008329	signaling pattern recognition receptor activity	IDA	molecular function
GO:0009986	cell surface	IDA	cellular component
GO:0010628	positive regulation of gene expression	IMP	biological process
GO:0016020	membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0030177	positive regulation of Wnt signaling pathway	IMP	biological process
GO:0030670	phagocytic vesicle membrane	IEA	cellular component
GO:0031226	intrinsic component of plasma membrane	IDA	cellular component
GO:0031410	cytoplasmic vesicle	IEA	cellular component
GO:0031663	lipopolysaccharide-mediated signaling pathway	IEA	biological process
GO:0032613	interleukin-10 production	IDA	biological process
GO:0032722	positive regulation of chemokine production	IDA	biological process
GO:0032728	positive regulation of interferon-beta production	ISS	biological process
GO:0032735	positive regulation of interleukin-12 production	ISS	biological process
GO:0032741	positive regulation of interleukin-18 production	ISS	biological process
GO:0032755	positive regulation of interleukin-6 production	IDA	biological process
GO:0032757	positive regulation of interleukin-8 production	IDA	biological process
GO:0032757	positive regulation of interleukin-8 production	IDA	biological process
GO:0032760	positive regulation of tumor necrosis factor production	ISS	biological process
GO:0034123	positive regulation of toll-like receptor signaling pathway	IDA	biological process
GO:0034134	toll-like receptor 2 signaling pathway	IEA	biological process
GO:0035325	Toll-like receptor binding	IPI	molecular function
GO:0035354	Toll-like receptor 1-Toll-like receptor 2 protein complex	IDA	cellular component
GO:0038123	toll-like receptor TLR1:TLR2 signaling pathway	TAS	biological process
GO:0038124	toll-like receptor TLR6:TLR2 signaling pathway	TAS	biological process
GO:0042346	positive regulation of NF-kappaB import into nucleus	IDA	biological process
GO:0042495	detection of triacyl bacterial lipopeptide	IDA	biological process
GO:0042496	detection of diacyl bacterial lipopeptide	IDA	biological process
GO:0042497	triacyl lipopeptide binding	IDA	molecular function
GO:0042834	peptidoglycan binding	IDA	molecular function
GO:0045087	innate immune response	IEA	biological process
GO:0045087	innate immune response	IEA	biological process
GO:0045087	innate immune response	TAS	biological process
GO:0045121	membrane raft	IEA	cellular component
GO:0045121	membrane raft	IDA	cellular component
GO:0045944	positive regulation of transcription from RNA polymerase II promoter	ISS	biological process
GO:0046982	protein heterodimerization activity	IDA	molecular function
GO:0050707	regulation of cytokine secretion	IEA	biological process
GO:0050729	positive regulation of inflammatory response	IEA	biological process
GO:0050729	positive regulation of inflammatory response	IC	biological process
GO:0050830	defense response to Gram-positive bacterium	IDA	biological process
GO:0051092	positive regulation of NF-kappaB transcription factor activity	IDA	biological process
GO:0051092	positive regulation of NF-kappaB transcription factor activity	IDA	biological process
GO:0051770	positive regulation of nitric-oxide synthase biosynthetic process	ISS	biological process
GO:0071221	cellular response to bacterial lipopeptide	TAS	biological process
GO:0071223	cellular response to lipoteichoic acid	IDA	biological process
GO:0071726	cellular response to diacyl bacterial lipopeptide	IDA	biological process
GO:0071726	cellular response to diacyl bacterial lipopeptide	IDA	biological process
GO:0071727	cellular response to triacyl bacterial lipopeptide	IDA	biological process
GO:0071727	cellular response to triacyl bacterial lipopeptide	IDA	biological process
GO:0001530	lipopolysaccharide binding	IDA	molecular function
GO:0001875	lipopolysaccharide receptor activity	TAS	molecular function
GO:0002374	cytokine secretion involved in immune response	IMP	biological process
GO:0002755	MyD88-dependent toll-like receptor signaling pathway	TAS	biological process
GO:0004872	receptor activity	TAS	molecular function
GO:0004872	receptor activity	IDA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005737	cytoplasm	IDA	cellular component
GO:0005794	Golgi apparatus	IDA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005887	integral component of plasma membrane	TAS	cellular component
GO:0006915	apoptotic process	TAS	biological process
GO:0006955	immune response	TAS	biological process
GO:0007165	signal transduction	TAS	biological process
GO:0007165	signal transduction	TAS	biological process
GO:0007165	signal transduction	TAS	biological process
GO:0007252	I-kappaB phosphorylation	IDA	biological process
GO:0008329	signaling pattern recognition receptor activity	IDA	molecular function
GO:0009986	cell surface	IDA	cellular component
GO:0010628	positive regulation of gene expression	IMP	biological process
GO:0030177	positive regulation of Wnt signaling pathway	IMP	biological process
GO:0031226	intrinsic component of plasma membrane	IDA	cellular component
GO:0032613	interleukin-10 production	IDA	biological process
GO:0032722	positive regulation of chemokine production	IDA	biological process
GO:0032728	positive regulation of interferon-beta production	ISS	biological process
GO:0032735	positive regulation of interleukin-12 production	ISS	biological process
GO:0032741	positive regulation of interleukin-18 production	ISS	biological process
GO:0032755	positive regulation of interleukin-6 production	IDA	biological process
GO:0032757	positive regulation of interleukin-8 production	IDA	biological process
GO:0032757	positive regulation of interleukin-8 production	IDA	biological process
GO:0032760	positive regulation of tumor necrosis factor production	ISS	biological process
GO:0034123	positive regulation of toll-like receptor signaling pathway	IDA	biological process
GO:0035325	Toll-like receptor binding	IPI	molecular function
GO:0035354	Toll-like receptor 1-Toll-like receptor 2 protein complex	IDA	cellular component
GO:0038123	toll-like receptor TLR1:TLR2 signaling pathway	TAS	biological process
GO:0038124	toll-like receptor TLR6:TLR2 signaling pathway	TAS	biological process
GO:0042346	positive regulation of NF-kappaB import into nucleus	IDA	biological process
GO:0042495	detection of triacyl bacterial lipopeptide	IDA	biological process
GO:0042496	detection of diacyl bacterial lipopeptide	IDA	biological process
GO:0042497	triacyl lipopeptide binding	IDA	molecular function
GO:0042834	peptidoglycan binding	IDA	molecular function
GO:0045087	innate immune response	TAS	biological process
GO:0045121	membrane raft	IDA	cellular component
GO:0045944	positive regulation of transcription from RNA polymerase II promoter	ISS	biological process
GO:0046982	protein heterodimerization activity	IDA	molecular function
GO:0050729	positive regulation of inflammatory response	IC	biological process
GO:0050830	defense response to Gram-positive bacterium	IDA	biological process
GO:0051092	positive regulation of NF-kappaB transcription factor activity	IDA	biological process
GO:0051092	positive regulation of NF-kappaB transcription factor activity	IDA	biological process
GO:0051770	positive regulation of nitric-oxide synthase biosynthetic process	ISS	biological process
GO:0071221	cellular response to bacterial lipopeptide	TAS	biological process
GO:0071223	cellular response to lipoteichoic acid	IDA	biological process
GO:0071726	cellular response to diacyl bacterial lipopeptide	IDA	biological process
GO:0071726	cellular response to diacyl bacterial lipopeptide	IDA	biological process
GO:0071727	cellular response to triacyl bacterial lipopeptide	IDA	biological process
GO:0071727	cellular response to triacyl bacterial lipopeptide	IDA	biological process

KEGG pathways

Pathway id	Pathway name
hsa04151	PI3K-Akt signaling pathway
hsa04145	Phagosome
hsa04620	Toll-like receptor signaling pathway
hsa05205	Proteoglycans in cancer
hsa05235	PD-L1 expression and PD-1 checkpoint pathway in cancer
hsa05323	Rheumatoid arthritis
hsa05321	Inflammatory bowel disease
hsa05134	Legionellosis
hsa05152	Tuberculosis
hsa05170	Human immunodeficiency virus 1 infection
hsa05162	Measles
hsa05161	Hepatitis B
hsa05168	Herpes simplex virus 1 infection
hsa05169	Epstein-Barr virus infection
hsa05146	Amoebiasis
hsa05144	Malaria
hsa05145	Toxoplasmosis
hsa05140	Leishmaniasis
hsa05142	Chagas disease

Diseases

Associated diseases	References
Cancer (bladder)	GAD: 19692168
Cancer (cervical)	GAD: 19012493
Cancer (colorectal)	GAD: 16879199
Cancer (endometrial)	GAD: 20646321
Cancer (glaucoma)	GAD: 20057905
Cancer (head and neck)	GAD: 20819778
Cancer (lung)	GAD: 18676680
Cancer (lymphoma)	GAD: 16971956
Cancer (meningeal)	GAD: 20406964
Cancer (myeloma)	GAD: 20568250
Cancer (prostate)	GAD: 19505919
Cancer (stomach)	GAD: 20363151
Cancer (breast)	GAD: 19810822
Cancer	GAD: 16971956
Cardiovascular disease	GAD: 17096074
Atherosclerosis	GAD: 11035751
Sarcoidosis	GAD: 17565608
Hodgkin disease	GAD: 19573080
Idiopathic thrombocytopenic purpura	GAD: 20626741
Allergy	GAD: 19763595
Arthritis	GAD: 20194452
Asthma	GAD: 15007351
Rheumatoid arthritis	GAD: 16712654
Ulcerative colitis	GAD: 17565650
Multiple sclerosis	GAD: 20595247
Periodontitis	GAD: 18062119
Systemic inflammatory response syndrome	GAD: 15753758
Systemic lupus erythematosus (SLE)	GAD: 14651524
Systemic lupus erythematosus (SLE)	GAD: 14651524
Atopy	GAD: 19849713
Behcet's disease	GAD: 16901312
Bronchial hyperreactivity	GAD: 21281869
Crohn's disease	GAD: 16374251
Hypersensitivity	GAD: 19254290
Amyloidosis	GAD: 17013994
Diabetes	GAD: 17130564
Insulin resistance	GAD: 20357716
Ankylosing spondylitis	GAD: 18073264
Chorioamnionitis	GAD: 20452482
Preeclampsia	GAD: 18651887
Preterm birth risk	GAD: 15516360
Poor ovarian response (POR)	INFBASE: 25083184
Pelvic inflammatory disease (PID)	INFBASE: 23255565
Polycystic ovary syndrome (PCOS)	INFBASE: 26498675
Leukocytospermia	MIK: 26227162
Male factor infertility	MIK: 26227162
Infertility	INFBASE: 26114934
Endometriosis-associated infertility	INFBASE: 26177128
Endometriosis	INFBASE: 26177128
Chronic obstructive pulmonary disease (COPD)	GAD: 19381722
Rhinitis	GAD: 19128592
Dermatitis	GAD: 18445187
Eczema	GAD: 20646366
Atopic dermatitis	KEGG: H01358
Connective tissue diseases	GAD: 19527514
Periodontal disease	GAD: 14738464
Bronchiectasis	GAD: 17207025
Leukocytospermia	MIK: 26227162
Male infertility	MIK: 26227162
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
26227162	Leukocytospermia, idiopathic male infertility			85 (38 non-LCS patients, 47 LCS patients)	Male infertility	TLR-2/4 COX-2 and Nrf-2
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)