• Gene id: 7095

Gene Summary

• Gene Symbol: SEC62   Gene   UCSC   Ensembl
• Aliases: Dtrp1, HTP1, TLOC1, TP-1
• Gene name: SEC62 homolog, preprotein translocation factor
• Alternate names: translocation protein SEC62, SEC62 preprotein translocation factor, hTP-1, membrane protein SEC62, S.cerevisiae, homolog of, translocation protein 1,
• Gene location: 3q26.2 (169966135: 169998372)     Exons: 9     NC_000003.12
• Gene summary(Entrez): The Sec61 complex is the central component of the protein translocation apparatus of the endoplasmic reticulum (ER) membrane. The protein encoded by this gene and SEC63 protein are found to be associated with ribosome-free SEC61 complex. It is speculated
• OMIM: 602173

Protein Summary

• Protein general information: Q99442  
  • Name: Translocation protein SEC62 (Translocation protein 1) (TP 1) (hTP 1)
  • Length: 399  
  • Mass: 45862
• Sequence:

  MAERRRHKKRIQEVGEPSKEEKAVAKYLRFNCPTKSTNMMGHRVDYFIASKAVDCLLDSKWAKAKKGEEALFTTR
  ESVVDYCNRLLKKQFFHRALKVMKMKYDKDIKKEKDKGKAESGKEEDKKSKKENIKDEKTKKEKEKKKDGEKEES
  KKEETPGTPKKKETKKKFKLEPHDDQVFLDGNEVYVWIYDPVHFKTFVMGLILVIAVIAATLFPLWPAEMRVGVY
  YLSVGAGCFVASILLLAVARCILFLIIWLITGGRHHFWFLPNLTADVGFIDSFRPLYTHEYKGPKADLKKDEKSE
  TKKQQKSDSEEKSDSEKKEDEEGKVGPGNHGTEGSGGERHSDTDSDRREDDRSQHSSGNGNDFEMITKEELEQQT
  DGDCEEDEEEENDGETPKSSHEKS

• Structural information:
  • Interpro: IPR004728  
  • STRING: ENSP00000337688
• Other Databases: GeneCards:  SEC62  Malacards:  SEC62

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005783	endoplasmic reticulum	IBA	cellular component
GO:0031204	posttranslational protein targeting to membrane, translocation	IBA	biological process
GO:0016020	membrane	IBA	cellular component
GO:0031204	posttranslational protein targeting to membrane, translocation	IMP	biological process
GO:0030176	integral component of endoplasmic reticulum membrane	IEA	cellular component
GO:0015031	protein transport	IEA	biological process
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0015031	protein transport	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0015031	protein transport	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0038023	signaling receptor activity	TAS	molecular function
GO:0006613	cotranslational protein targeting to membrane	TAS	biological process
GO:0016021	integral component of membrane	TAS	cellular component
GO:0005783	endoplasmic reticulum	TAS	cellular component
GO:0016020	membrane	IDA	cellular component
GO:0006620	posttranslational protein targeting to endoplasmic reticulum membrane	IMP	biological process
GO:0005789	endoplasmic reticulum membrane	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005789	endoplasmic reticulum membrane	IEA	cellular component
GO:0005791	rough endoplasmic reticulum	ISS	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04141	Protein processing in endoplasmic reticulum
hsa03060	Protein export

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881