• Gene id: 7091

Gene Summary

• Gene Symbol: TLE4   Gene   UCSC   Ensembl
• Aliases: BCE-1, BCE1, E(spI), E(spl), ESG, ESG4, GRG4, Grg-4
• Gene name: TLE family member 4, transcriptional corepressor
• Alternate names: transducin-like enhancer protein 4, B lymphocyte gene 1, enhancer of split groucho 4, groucho-related protein 4, transducin like enhancer of split 4, transducin-like enhancer of split 4 (E(sp1) homolog, Drosophila), transducin-like enhancer of split 4, homolog ,
• Gene location: 9q21.31 (79571772: 79726881)     Exons: 20     NC_000009.12
• OMIM: 605132

Protein Summary

• Protein general information: Q04727  
  • Name: Transducin like enhancer protein 4 (Grg 4) (Groucho related protein 4)
  • Length: 773  
  • Mass: 83755
  • Tissue specificity: In all tissues examined, mostly in brain, and muscle.
• Sequence:

  MIRDLSKMYPQTRHPAPHQPAQPFKFTISESCDRIKEEFQFLQAQYHSLKLECEKLASEKTEMQRHYVMYYEMSY
  GLNIEMHKQAEIVKRLNAICAQVIPFLSQEHQQQVVQAVERAKQVTMAELNAIIGQQLQAQHLSHGHGLPVPLTP
  HPSGLQPPAIPPIGSSAGLLALSSALGGQSHLPIKDEKKHHDNDHQRDRDSIKSSSVSPSASFRGAEKHRNSADY
  SSESKKQKTEEKEIAARYDSDGEKSDDNLVVDVSNEDPSSPRGSPAHSPRENGLDKTRLLKKDAPISPASIASSS
  STPSSKSKELSLNEKSTTPVSKSNTPTPRTDAPTPGSNSTPGLRPVPGKPPGVDPLASSLRTPMAVPCPYPTPFG
  IVPHAGMNGELTSPGAAYAGLHNISPQMSAAAAAAAAAAAYGRSPVVGFDPHHHMRVPAIPPNLTGIPGGKPAYS
  FHVSADGQMQPVPFPPDALIGPGIPRHARQINTLNHGEVVCAVTISNPTRHVYTGGKGCVKVWDISHPGNKSPVS
  QLDCLNRDNYIRSCRLLPDGRTLIVGGEASTLSIWDLAAPTPRIKAELTSSAPACYALAISPDSKVCFSCCSDGN
  IAVWDLHNQTLVRQFQGHTDGASCIDISNDGTKLWTGGLDNTVRSWDLREGRQLQQHDFTSQIFSLGYCPTGEWL
  AVGMENSNVEVLHVTKPDKYQLHLHESCVLSLKFAHCGKWFVSTGKDNLLNAWRTPYGASIFQSKESSSVLSCDI
  SVDDKYIVTGSGDKKATVYEVIY

• Structural information:
  • Interpro: IPR005617  IPR009146  IPR015943  IPR001680  IPR019775   IPR017986  IPR036322  
  • Prosite: PS00678 PS50082 PS50294
  • STRING: ENSP00000365720
• Other Databases: GeneCards:  TLE4  Malacards:  TLE4

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0090090	negative regulation of canonical Wnt signaling pathway	IBA	biological process
GO:0070491	repressing transcription factor binding	IBA	molecular function
GO:0005667	transcription regulator complex	IBA	cellular component
GO:0005634	nucleus	IBA	cellular component
GO:0003714	transcription corepressor activity	IBA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0006355	regulation of transcription, DNA-templated	IEA	biological process
GO:0016055	Wnt signaling pathway	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:1990907	beta-catenin-TCF complex	IDA	cellular component
GO:1904837	beta-catenin-TCF complex assembly	TAS	biological process
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0000122	negative regulation of transcription by RNA polymerase II	IEA	biological process
GO:0000981	DNA-binding transcription factor activity, RNA polymerase II-specific	IEA	molecular function
GO:0003714	transcription corepressor activity	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0070491	repressing transcription factor binding	IEA	molecular function
GO:1990830	cellular response to leukemia inhibitory factor	IEA	biological process
GO:0003682	chromatin binding	IEA	molecular function
GO:0016055	Wnt signaling pathway	IEA	biological process
GO:0045892	negative regulation of transcription, DNA-templated	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0008150	biological_process	ND	biological process
GO:0005634	nucleus	NAS	cellular component
GO:0003674	molecular_function	ND	molecular function
GO:0005634	nucleus	HDA	cellular component

Diseases

Associated diseases	References
Hypospermatogenesis	MIK: 28361989
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
28361989	Hypospermatogenesis			6 (3 controls, 3 Klienfelter syndrome	Male infertility	Microarray
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R