• Gene id: 7090

Gene Summary

• Gene Symbol: TLE3   Gene   UCSC   Ensembl
• Aliases: ESG, ESG3, GRG3, HsT18976
• Gene name: TLE family member 3, transcriptional corepressor
• Alternate names: transducin-like enhancer protein 3, enhancer of split groucho 3, enhancer of split groucho-like protein 3, transducin like enhancer of split 3, transducin-like enhancer of split 3 (E(sp1) homolog, Drosophila), transducin-like enhancer of split 3 short isoform, ,
• Gene location: 15q23 (70098170: 70047789)     Exons: 23     NC_000015.10
• Gene summary(Entrez): This gene encodes a transcriptional co-repressor protein that belongs to the transducin-like enhancer family of proteins. The members of this family function in the Notch signaling pathway that regulates determination of cell fate during development. Expr
• OMIM: 190930

Protein Summary

• Protein general information: Q04726  
  • Name: Transducin like enhancer protein 3 (Enhancer of split groucho like protein 3) (ESG3)
  • Length: 772  
  • Mass: 83417
  • Tissue specificity: Placenta and lung.
• Sequence:

  MYPQGRHPAPHQPGQPGFKFTVAESCDRIKDEFQFLQAQYHSLKVEYDKLANEKTEMQRHYVMYYEMSYGLNIEM
  HKQTEIAKRLNTILAQIMPFLSQEHQQQVAQAVERAKQVTMTELNAIIGQQQLQAQHLSHATHGPPVQLPPHPSG
  LQPPGIPPVTGSSSGLLALGALGSQAHLTVKDEKNHHELDHRERESSANNSVSPSESLRASEKHRGSADYSMEAK
  KRKAEEKDSLSRYDSDGDKSDDLVVDVSNEDPATPRVSPAHSPPENGLDKARSLKKDAPTSPASVASSSSTPSSK
  TKDLGHNDKSSTPGLKSNTPTPRNDAPTPGTSTTPGLRSMPGKPPGMDPIGIMASALRTPISITSSYAAPFAMMS
  HHEMNGSLTSPGAYAGLHNIPPQMSAAAAAAAAAYGRSPMVSFGAVGFDPHPPMRATGLPSSLASIPGGKPAYSF
  HVSADGQMQPVPFPHDALAGPGIPRHARQINTLSHGEVVCAVTISNPTRHVYTGGKGCVKIWDISQPGSKSPISQ
  LDCLNRDNYIRSCKLLPDGRTLIVGGEASTLTIWDLASPTPRIKAELTSSAPACYALAISPDAKVCFSCCSDGNI
  AVWDLHNQTLVRQFQGHTDGASCIDISHDGTKLWTGGLDNTVRSWDLREGRQLQQHDFTSQIFSLGYCPTGEWLA
  VGMESSNVEVLHHTKPDKYQLHLHESCVLSLKFAYCGKWFVSTGKDNLLNAWRTPYGASIFQSKESSSVLSCDIS
  ADDKYIVTGSGDKKATVYEVIY

• Structural information:
  • Interpro: IPR005617  IPR009146  IPR015943  IPR001680  IPR019775   IPR017986  IPR036322  
  • Prosite: PS00678 PS50082 PS50294
  • DIP: 36666
  • STRING: ENSP00000452871
• Other Databases: GeneCards:  TLE3  Malacards:  TLE3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0090090	negative regulation of canonical Wnt signaling pathway	IBA	biological process
GO:0070491	repressing transcription factor binding	IBA	molecular function
GO:0005667	transcription regulator complex	IBA	cellular component
GO:0005634	nucleus	IBA	cellular component
GO:0003714	transcription corepressor activity	IBA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0006355	regulation of transcription, DNA-templated	IEA	biological process
GO:0016055	Wnt signaling pathway	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0005634	nucleus	TAS	cellular component
GO:0007165	signal transduction	TAS	biological process
GO:0009887	animal organ morphogenesis	TAS	biological process
GO:1990907	beta-catenin-TCF complex	IDA	cellular component
GO:1904837	beta-catenin-TCF complex assembly	TAS	biological process
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0120163	negative regulation of cold-induced thermogenesis	IEA	biological process
GO:0006355	regulation of transcription, DNA-templated	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0120163	negative regulation of cold-induced thermogenesis	ISS	biological process
GO:1903507	negative regulation of nucleic acid-templated transcription	IEA	biological process
GO:0005515	protein binding	IPI	molecular function

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200
Spermatogenic defects	MIK: 31037746

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
31037746	Spermatogenic defects			28 men with azoospermia	Male infertility	Microarray