• Gene id: 7088

Gene Summary

• Gene Symbol: TLE1   Gene   UCSC   Ensembl
• Aliases: ESG, ESG1, GRG1
• Gene name: TLE family member 1, transcriptional corepressor
• Alternate names: transducin-like enhancer protein 1, enhancer of split groucho-like protein 1, transducin like enhancer of split 1, transducin-like enhancer of split 1 (E(sp1) homolog, Drosophila),
• Gene location: 9q21.32 (33373708: 33382685)     Exons: 3     NC_000019.10
• OMIM: 600189

Protein Summary

• Protein general information: Q04724  
  • Name: Transducin like enhancer protein 1 (E(Sp1) homolog) (Enhancer of split groucho like protein 1) (ESG1)
  • Length: 770  
  • Mass: 83201
  • Tissue specificity: In all tissues examined, mostly in brain, liver and muscle.
• Sequence:

  MFPQSRHPTPHQAAGQPFKFTIPESLDRIKEEFQFLQAQYHSLKLECEKLASEKTEMQRHYVMYYEMSYGLNIEM
  HKQTEIAKRLNTICAQVIPFLSQEHQQQVAQAVERAKQVTMAELNAIIGQQQLQAQHLSHGHGPPVPLTPHPSGL
  QPPGIPPLGGSAGLLALSSALSGQSHLAIKDDKKHHDAEHHRDREPGTSNSLLVPDSLRGTDKRRNGPEFSNDIK
  KRKVDDKDSSHYDSDGDKSDDNLVVDVSNEDPSSPRASPAHSPRENGIDKNRLLKKDASSSPASTASSASSTSLK
  SKEMSLHEKASTPVLKSSTPTPRSDMPTPGTSATPGLRPGLGKPPAIDPLVNQAAAGLRTPLAVPGPYPAPFGMV
  PHAGMNGELTSPGAAYASLHNMSPQMSAAAAAAAVVAYGRSPMVGFDPPPHMRVPTIPPNLAGIPGGKPAYSFHV
  TADGQMQPVPFPPDALIGPGIPRHARQINTLNHGEVVCAVTISNPTRHVYTGGKGCVKVWDISHPGNKSPVSQLD
  CLNRDNYIRSCKLLPDGCTLIVGGEASTLSIWDLAAPTPRIKAELTSSAPACYALAISPDSKVCFSCCSDGNIAV
  WDLHNQTLVRQFQGHTDGASCIDISNDGTKLWTGGLDNTVRSWDLREGRQLQQHDFTSQIFSLGYCPTGEWLAVG
  MESSNVEVLHVNKPDKYQLHLHESCVLSLKFAYCGKWFVSTGKDNLLNAWRTPYGASIFQSKESSSVLSCDISVD
  DKYIVTGSGDKKATVYEVIY

• Structural information:
  • Interpro: IPR005617  IPR009146  IPR015943  IPR001680  IPR019775   IPR017986  IPR036322  
  • Prosite: PS00678 PS50082 PS50294
  • PDB: 1GXR 2CE8 2CE9 4OM2 4OM3 5MWJ
  • PDBsum: 1GXR 2CE8 2CE9 4OM2 4OM3 5MWJ
  • DIP: 36665
  • STRING: ENSP00000365682
• Other Databases: GeneCards:  TLE1  Malacards:  TLE1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0090090	negative regulation of canonical Wnt signaling pathway	IBA	biological process
GO:0070491	repressing transcription factor binding	IBA	molecular function
GO:0005667	transcription regulator complex	IBA	cellular component
GO:0005634	nucleus	IBA	cellular component
GO:0003714	transcription corepressor activity	IBA	molecular function
GO:0043124	negative regulation of I-kappaB kinase/NF-kappaB signaling	IDA	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0006355	regulation of transcription, DNA-templated	IEA	biological process
GO:0016055	Wnt signaling pathway	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0005634	nucleus	TAS	cellular component
GO:0007275	multicellular organism development	TAS	biological process
GO:0007165	signal transduction	TAS	biological process
GO:0009887	animal organ morphogenesis	TAS	biological process
GO:1990907	beta-catenin-TCF complex	IDA	cellular component
GO:1904837	beta-catenin-TCF complex assembly	TAS	biological process
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0042802	identical protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0003714	transcription corepressor activity	IDA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IDA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0045892	negative regulation of transcription, DNA-templated	IDA	biological process
GO:0008134	transcription factor binding	IDA	molecular function
GO:0005829	cytosol	IMP	cellular component
GO:2000811	negative regulation of anoikis	IMP	biological process
GO:2000811	negative regulation of anoikis	IMP	biological process
GO:0008134	transcription factor binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0010628	positive regulation of gene expression	IMP	biological process
GO:0030178	negative regulation of Wnt signaling pathway	NAS	biological process
GO:0005634	nucleus	IMP	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq