• Gene id: 7087

Gene Summary

• Gene Symbol: ICAM5   Gene   UCSC   Ensembl
• Aliases: TLCN, TLN
• Gene name: intercellular adhesion molecule 5
• Alternate names: intercellular adhesion molecule 5, ICAM-5, intercellular adhesion molecule 5, telencephalin, telencephalin,
• Gene location: 19p13.2 (10289350: 10296777)     Exons: 11     NC_000019.10
• Gene summary(Entrez): The protein encoded by this gene is a member of the intercellular adhesion molecule (ICAM) family. All ICAM proteins are type I transmembrane glycoproteins, contain 2-9 immunoglobulin-like C2-type domains, and bind to the leukocyte adhesion LFA-1 protein.

Protein Summary

• Protein general information: Q9UMF0  
  • Name: Intercellular adhesion molecule 5 (ICAM 5) (Telencephalin)
  • Length: 924  
  • Mass: 97116
  • Tissue specificity: Expressed on neurons in the most rostral segment of the mammalian brain, the telencephalon.
• Sequence:

  MPGPSPGLRRALLGLWAALGLGLFGLSAVSQEPFWADLQPRVAFVERGGSLWLNCSTNCPRPERGGLETSLRRNG
  TQRGLRWLARQLVDIREPETQPVCFFRCARRTLQARGLIRTFQRPDRVELMPLPPWQPVGENFTLSCRVPGAGPR
  ASLTLTLLRGAQELIRRSFAGEPPRARGAVLTATVLARREDHGANFSCRAELDLRPHGLGLFENSSAPRELRTFS
  LSPDAPRLAAPRLLEVGSERPVSCTLDGLFPASEARVYLALGDQNLSPDVTLEGDAFVATATATASAEQEGARQL
  VCNVTLGGENRETRENVTIYSFPAPLLTLSEPSVSEGQMVTVTCAAGAQALVTLEGVPAAVPGQPAQLQLNATEN
  DDRRSFFCDATLDVDGETLIKNRSAELRVLYAPRLDDSDCPRSWTWPEGPEQTLRCEARGNPEPSVHCARSDGGA
  VLALGLLGPVTRALSGTYRCKAANDQGEAVKDVTLTVEYAPALDSVGCPERITWLEGTEASLSCVAHGVPPPDVI
  CVRSGELGAVIEGLLRVAREHAGTYRCEATNPRGSAAKNVAVTVEYGPRFEEPSCPSNWTWVEGSGRLFSCEVDG
  KPQPSVKCVGSGGATEGVLLPLAPPDPSPRAPRIPRVLAPGIYVCNATNRHGSVAKTVVVSAESPPEMDESTCPS
  HQTWLEGAEASALACAARGRPSPGVRCSREGIPWPEQQRVSREDAGTYHCVATNAHGTDSRTVTVGVEYRPVVAE
  LAASPPGGVRPGGNFTLTCRAEAWPPAQISWRAPPGALNIGLSSNNSTLSVAGAMGSHGGEYECAATNAHGRHAR
  RITVRVAGPWLWVAVGGAAGGAALLAAGAGLAFYVQSTACKKGEYNVQEAESSGEAVCLNGAGGGAGGAAGAEGG
  PEAAGGAAESPAEGEVFAIQLTSA

• Structural information:
  • Protein Domains: (48..13-)
    1 (/note="Ig-like-C2-type)
    (135..23-)
    2 (/note="Ig-like-C2-type)
    (242..32-)
    3 (/note="Ig-like-C2-type)
    (337..40-)
    4 (/note="Ig-like-C2-type)
    (408..48-)
    5 (/note="Ig-like-C2-type)
    (491..56-)
    (/note="Ig-lik-)
  • Interpro: IPR003988  IPR013768  IPR003987  IPR007110  IPR036179   IPR013783  IPR003599  IPR003598  
  • Prosite: PS50835
  • PDB: 3BN3 4OI9 4OIA 4OIB
  • PDBsum: 3BN3 4OI9 4OIA 4OIB
  • STRING: ENSP00000221980
• Other Databases: GeneCards:  ICAM5  Malacards:  ICAM5

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005178	integrin binding	IBA	molecular function
GO:0005887	integral component of plasma membrane	IBA	cellular component
GO:0007155	cell adhesion	IBA	biological process
GO:0098609	cell-cell adhesion	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0007155	cell adhesion	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005887	integral component of plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0030198	extracellular matrix organization	TAS	biological process
GO:0050776	regulation of immune response	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0006909	phagocytosis	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881