• Gene id: 7083

Gene Summary

• Gene Symbol: TK1   Gene   UCSC   Ensembl
• Aliases: TK2
• Gene name: thymidine kinase 1
• Alternate names: thymidine kinase, cytosolic, cytosolic thymidine kinase, epididymis secretory sperm binding protein, thymidine kinase 1 soluble isoform,
• Gene location: 17q25.3 (78187203: 78174078)     Exons: 6     NC_000017.11
• Gene summary(Entrez): The protein encoded by this gene is a cytosolic enzyme that catalyzes the addition of a gamma-phosphate group to thymidine. This creates dTMP and is the first step in the biosynthesis of dTTP, which is one component required for DNA replication. The encod
• OMIM: 606883

SNPs

rs7867029

Strand:    Allele origin:   Allele change:   Mutation type: snv

NC_000009.12   g.78405502G>C
NC_000009.11   g.81020418G>C|SEQ=[G/C]|GENE=LOC107987083

Protein Summary

• Protein general information: P04183  
  • Name: Thymidine kinase, cytosolic (EC 2.7.1.21)
  • Length: 234  
  • Mass: 25469
• Sequence:

  MSCINLPTVLPGSPSKTRGQIQVILGPMFSGKSTELMRRVRRFQIAQYKCLVIKYAKDTRYSSSFCTHDRNTMEA
  LPACLLRDVAQEALGVAVIGIDEGQFFPDIVEFCEAMANAGKTVIVAALDGTFQRKPFGAILNLVPLAESVVKLT
  AVCMECFREAAYTKRLGTEKEVEVIGGADKYHSVCRLCYFKKASGQPAGPDNKENCPVPGKPGEAVAARKLFAPQ
  QILQCSPAN

• Structural information:
  • Interpro: IPR027417  IPR001267  IPR020633  
  • Prosite: PS00603
  • PDB: 1W4R 1XBT 2ORV 2WVJ
  • PDBsum: 1W4R 1XBT 2ORV 2WVJ
  • STRING: ENSP00000301634
• Other Databases: GeneCards:  TK1  Malacards:  TK1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0004797	thymidine kinase activity	IBA	molecular function
GO:0046104	thymidine metabolic process	IBA	biological process
GO:0008270	zinc ion binding	IDA	molecular function
GO:0051289	protein homotetramerization	IPI	biological process
GO:0004797	thymidine kinase activity	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0016301	kinase activity	IEA	molecular function
GO:0016740	transferase activity	IEA	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0000166	nucleotide binding	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0016310	phosphorylation	IEA	biological process
GO:0071897	DNA biosynthetic process	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0004797	thymidine kinase activity	TAS	molecular function
GO:0006139	nucleobase-containing compound metabolic process	TAS	biological process
GO:0004797	thymidine kinase activity	IEA	molecular function
GO:0043097	pyrimidine nucleoside salvage	TAS	biological process
GO:0005829	cytosol	TAS	cellular component
GO:0042802	identical protein binding	IPI	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0009157	deoxyribonucleoside monophosphate biosynthetic process	IEA	biological process
GO:0009157	deoxyribonucleoside monophosphate biosynthetic process	IEA	biological process
GO:0009157	deoxyribonucleoside monophosphate biosynthetic process	IEA	biological process
GO:0009157	deoxyribonucleoside monophosphate biosynthetic process	IEA	biological process

KEGG pathways

Pathway id	Pathway name
hsa01100	Metabolic pathways
hsa00983	Drug metabolism - other enzymes
hsa00240	Pyrimidine metabolism

Diseases

Associated diseases	References
Breast cancer	PMID:10883887
Cervix carcinoma	PMID:11474248
lung non-small cell carcinoma	PMID:15583816
Spermatogenic defects	MIK: 31037746

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
31037746	Spermatogenic defects			28 men with azoospermia	Male infertility	Microarray