• Gene id: 7079

Gene Summary

• Gene Symbol: TIMP4   Gene   UCSC   Ensembl
• Aliases: TIMP-4
• Gene name: TIMP metallopeptidase inhibitor 4
• Alternate names: metalloproteinase inhibitor 4, tissue inhibitor of metalloproteinase 4, tissue inhibitor of metalloproteinases 4,
• Gene location: 3p25.2 (12158911: 12153067)     Exons: 5     NC_000003.12
• Gene summary(Entrez): This gene belongs to the TIMP gene family. The proteins encoded by this gene family are inhibitors of the matrix metalloproteinases, a group of peptidases involved in degradation of the extracellular matrix. The secreted, netrin domain-containing protein

Protein Summary

• Protein general information: Q99727  
  • Name: Metalloproteinase inhibitor 4 (Tissue inhibitor of metalloproteinases 4) (TIMP 4)
  • Length: 224  
  • Mass: 25503
  • Tissue specificity: Abundant in heart and present at low levels in many other tissues.
• Sequence:

  MPGSPRPAPSWVLLLRLLALLRPPGLGEACSCAPAHPQQHICHSALVIRAKISSEKVVPASADPADTEKMLRYEI
  KQIKMFKGFEKVKDVQYIYTPFDSSLCGVKLEANSQKQYLLTGQVLSDGKVFIHLCNYIEPWEDLSLVQRESLNH
  HYHLNCGCQITTCYTVPCTISAPNECLWTDWLLERKLYGYQAQHYVCMKHVDGTCSWYRGHLPLRKEFVDIVQP

• Structural information:
  • Protein Domains: (30..15-)
    (/note="NTR-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00295"-)
  • Interpro: IPR001134  IPR001820  IPR008993  IPR015614  IPR027465   IPR030490  
  • Prosite: PS50189 PS00288
  • STRING: ENSP00000287814
• Other Databases: GeneCards:  TIMP4  Malacards:  TIMP4

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005615	extracellular space	IBA	cellular component
GO:0010033	response to organic substance	IBA	biological process
GO:0031012	extracellular matrix	IBA	cellular component
GO:0034097	response to cytokine	IBA	biological process
GO:0051045	negative regulation of membrane protein ectodomain proteolysis	IBA	biological process
GO:0002020	protease binding	IBA	molecular function
GO:0008191	metalloendopeptidase inhibitor activity	IBA	molecular function
GO:0009725	response to hormone	IBA	biological process
GO:0010951	negative regulation of endopeptidase activity	IBA	biological process
GO:0008191	metalloendopeptidase inhibitor activity	IEA	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0004857	enzyme inhibitor activity	IEA	molecular function
GO:0030414	peptidase inhibitor activity	IEA	molecular function
GO:0010466	negative regulation of peptidase activity	IEA	biological process
GO:0046872	metal ion binding	IEA	molecular function
GO:0008191	metalloendopeptidase inhibitor activity	IEA	molecular function
GO:0009725	response to hormone	IEA	biological process
GO:0030017	sarcomere	IEA	cellular component
GO:0032496	response to lipopolysaccharide	IEA	biological process
GO:0042493	response to drug	IEA	biological process
GO:0043434	response to peptide hormone	IEA	biological process
GO:0007219	Notch signaling pathway	IEA	biological process
GO:0005615	extracellular space	IEA	cellular component
GO:0007417	central nervous system development	IEA	biological process
GO:0034097	response to cytokine	IEA	biological process
GO:0042698	ovulation cycle	IEA	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0008191	metalloendopeptidase inhibitor activity	NAS	molecular function
GO:0008150	biological_process	ND	biological process

Diseases

Associated diseases	References
Ductal carcinoma in situ	PMID:14744773
Endometrial cancer	PMID:15273280
nephroblastoma	PMID:11466614
Endometrial carcinoma	PMID:12798711
ovarian carcinoma	PMID:17009974
cervical cancer	PMID:15816637
renal cell carcinoma	PMID:11576837
prostate carcinoma in situ	PMID:16940965
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881