• Gene id: 7076

Gene Summary

• Gene Symbol: TIMP1   Gene   UCSC   Ensembl
• Aliases: CLGI, EPA, EPO, HCI, TIMP, TIMP-1
• Gene name: TIMP metallopeptidase inhibitor 1
• Alternate names: metalloproteinase inhibitor 1, collagenase inhibitor, erythroid potentiating activity, fibroblast collagenase inhibitor, tissue inhibitor of metalloproteinases 1,
• Gene location: Xp11.3 (47582290: 47586790)     Exons: 6     NC_000023.11
• Gene summary(Entrez): This gene belongs to the TIMP gene family. The proteins encoded by this gene family are natural inhibitors of the matrix metalloproteinases (MMPs), a group of peptidases involved in degradation of the extracellular matrix. In addition to its inhibitory ro
• OMIM: 305370

Protein Summary

• Protein general information: P01033  
  • Name: Metalloproteinase inhibitor 1 (Erythroid potentiating activity) (EPA) (Fibroblast collagenase inhibitor) (Collagenase inhibitor) (Tissue inhibitor of metalloproteinases 1) (TIMP 1)
  • Length: 207  
  • Mass: 23,171
• Sequence:

  MAPFEPLASGILLLLWLIAPSRACTCVPPHPQTAFCNSDLVIRAKFVGTPEVNQTTLYQRYEIKMTKMYKGFQAL
  GDAADIRFVYTPAMESVCGYFHRSHNRSEEFLIAGKLQDGLLHITTCSFVAPWNSLSLAQRRGFTKTYTVGCEEC
  TVFPCLSIPCKLQSGTHCLWTDQLLQGSEKGFQSRHLACLPREPGLCTWQSLRSQIA

• Structural information:
  • Protein Domains: NTR. (24-147)
  • Interpro: IPR001134  IPR001820  IPR008993  IPR015611  IPR027465   IPR030490  
  • Prosite: PS50189 PS00288
  • PDB: 1D2B 1LQN 1OO9 1UEA 2J0T 3MA2 3V96
  • PDBsum: 1D2B 1LQN 1OO9 1UEA 2J0T 3MA2 3V96
  • DIP: 1107
  • STRING: ENSP00000218388
• Other Databases: GeneCards:  TIMP1  Malacards:  TIMP1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0001775	cell activation	IEA	biological process
GO:0002020	protease binding	IBA	molecular function
GO:0002576	platelet degranulation	TAS	biological process
GO:0005125	cytokine activity	IDA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005576	extracellular region	NAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005578	proteinaceous extracellular matrix	IBA	cellular component
GO:0005604	basement membrane	IEA	cellular component
GO:0005615	extracellular space	IDA	cellular component
GO:0007568	aging	IEA	biological process
GO:0008083	growth factor activity	IEA	molecular function
GO:0008191	metalloendopeptidase inhibitor activity	IDA	molecular function
GO:0008191	metalloendopeptidase inhibitor activity	IDA	molecular function
GO:0008284	positive regulation of cell proliferation	IDA	biological process
GO:0009725	response to hormone	IBA	biological process
GO:0010951	negative regulation of endopeptidase activity	IDA	biological process
GO:0022617	extracellular matrix disassembly	TAS	biological process
GO:0031093	platelet alpha granule lumen	TAS	cellular component
GO:0034097	response to cytokine	IBA	biological process
GO:0042060	wound healing	IEA	biological process
GO:0043066	negative regulation of apoptotic process	IEA	biological process
GO:0043086	negative regulation of catalytic activity	IDA	biological process
GO:0043434	response to peptide hormone	IEA	biological process
GO:0046872	metal ion binding	IEA	molecular function
GO:0051045	negative regulation of membrane protein ectodomain proteolysis	IDA	biological process
GO:0051216	cartilage development	IEA	biological process
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:1901164	negative regulation of trophoblast cell migration	IMP	biological process
GO:2001044	regulation of integrin-mediated signaling pathway	IMP	biological process
GO:0001775	cell activation	IEA	biological process
GO:0002020	protease binding	IEA	molecular function
GO:0002020	protease binding	IBA	molecular function
GO:0002576	platelet degranulation	TAS	biological process
GO:0004857	enzyme inhibitor activity	IEA	molecular function
GO:0005125	cytokine activity	IDA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0005576	extracellular region	IEA	cellular component
GO:0005576	extracellular region	NAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005578	proteinaceous extracellular matrix	IEA	cellular component
GO:0005578	proteinaceous extracellular matrix	IBA	cellular component
GO:0005604	basement membrane	IEA	cellular component
GO:0005615	extracellular space	IDA	cellular component
GO:0007568	aging	IEA	biological process
GO:0008083	growth factor activity	IEA	molecular function
GO:0008191	metalloendopeptidase inhibitor activity	IEA	molecular function
GO:0008191	metalloendopeptidase inhibitor activity	IEA	molecular function
GO:0008191	metalloendopeptidase inhibitor activity	IDA	molecular function
GO:0008191	metalloendopeptidase inhibitor activity	IDA	molecular function
GO:0008284	positive regulation of cell proliferation	IDA	biological process
GO:0009725	response to hormone	IBA	biological process
GO:0010033	response to organic substance	IEA	biological process
GO:0010466	negative regulation of peptidase activity	IEA	biological process
GO:0010951	negative regulation of endopeptidase activity	IDA	biological process
GO:0022617	extracellular matrix disassembly	TAS	biological process
GO:0030414	peptidase inhibitor activity	IEA	molecular function
GO:0031012	extracellular matrix	IEA	cellular component
GO:0031093	platelet alpha granule lumen	TAS	cellular component
GO:0034097	response to cytokine	IEA	biological process
GO:0034097	response to cytokine	IBA	biological process
GO:0042060	wound healing	IEA	biological process
GO:0043066	negative regulation of apoptotic process	IEA	biological process
GO:0043086	negative regulation of catalytic activity	IDA	biological process
GO:0043434	response to peptide hormone	IEA	biological process
GO:0046872	metal ion binding	IEA	molecular function
GO:0051045	negative regulation of membrane protein ectodomain proteolysis	IDA	biological process
GO:0051216	cartilage development	IEA	biological process
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:1901164	negative regulation of trophoblast cell migration	IMP	biological process
GO:2001044	regulation of integrin-mediated signaling pathway	IMP	biological process
GO:0002020	protease binding	IBA	molecular function
GO:0002576	platelet degranulation	TAS	biological process
GO:0005125	cytokine activity	IDA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005576	extracellular region	NAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005578	proteinaceous extracellular matrix	IBA	cellular component
GO:0005615	extracellular space	IDA	cellular component
GO:0008191	metalloendopeptidase inhibitor activity	IDA	molecular function
GO:0008191	metalloendopeptidase inhibitor activity	IDA	molecular function
GO:0008284	positive regulation of cell proliferation	IDA	biological process
GO:0009725	response to hormone	IBA	biological process
GO:0010951	negative regulation of endopeptidase activity	IDA	biological process
GO:0022617	extracellular matrix disassembly	TAS	biological process
GO:0031093	platelet alpha granule lumen	TAS	cellular component
GO:0034097	response to cytokine	IBA	biological process
GO:0043086	negative regulation of catalytic activity	IDA	biological process
GO:0051045	negative regulation of membrane protein ectodomain proteolysis	IDA	biological process
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:1901164	negative regulation of trophoblast cell migration	IMP	biological process
GO:2001044	regulation of integrin-mediated signaling pathway	IMP	biological process

KEGG pathways

Pathway id	Pathway name
hsa04066	HIF-1 signaling pathway

Diseases

Associated diseases	References
Cancer (rectal)	GAD: 14687791
Cancer (endometrial)	GAD: 19758569
Cancer (lymphoma)	GAD: 18636124
Cancer (ovarian)	GAD: 20628624
Abdominal aortic aneurysm	GAD: 15944607
Aortic aneurysm	GAD: 15944607
Cardiovascular disease	GAD: 17893005
Aneurysm	GAD: 17182940
Brain aneurysm	GAD: 14605322
Intracranial aneurysm	GAD: 14605322
Restenosis	GAD: 12082592
Myopia	GAD: 16935611
Crohn's disease	GAD: 17589947
Arthritis	GAD: 11981324
Asthma	GAD: 16061701
Alzheimer's disease	GAD: 12218659
Chorioamnionitis	GAD: 20452482
Ectopic endometriosis	INFBASE: 15733405
Endometriosis	INFBASE: 11331642
Recurrent pregnancy loss (RPL)	INFBASE: 17156190
Successful implantation and pregnancy in human IVF	INFBASE: 16135009
Unexplained infertility	INFBASE: 12895377
Abnormal sperm sample	MIK: 12185105
Azoospermia	MIK: 12406369
Impaired reproduction	INFBASE: 18292822
Implantation failure	INFBASE: 17156190
Chronic obstructive pulmonary disease (COPD)	GAD: 19797132
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Abnormal sperm sample	MIK: 12185105
Azoospermia	MIK: 12406369
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
12185105	Abnormal sperm sample			70 (35 normal sperm samples, 35 abnormal sperm samples)	Male infertility	MMP2 TIMP-1
12406369	Azoospermia				Male infertility	TIMP-1 TIMP-2
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881