• Gene id: 7074

Gene Summary

• Gene Symbol: TIAM1   Gene   UCSC   Ensembl
• Aliases: TIAM-1
• Gene name: TIAM Rac1 associated GEF 1
• Alternate names: T-lymphoma invasion and metastasis-inducing protein 1, T cell lymphoma invasion and metastasis 1, human T-lymphoma invasion and metastasis inducing TIAM1 protein,
• Gene location: 21q22.11 (31559976: 31118417)     Exons: 37     NC_000021.9
• Gene summary(Entrez): This gene encodes a RAC1-specific guanine nucleotide exchange factor (GEF). GEFs mediate the exchange of guanosine diphosphate (GDP) for guanosine triphosphate (GTP). The binding of GTP induces a conformational change in RAC1 that allows downstream effect
• OMIM: 600687

Protein Summary

• Protein general information: Q13009  
  • Name: T lymphoma invasion and metastasis inducing protein 1 (TIAM 1)
  • Length: 1591  
  • Mass: 177508
  • Tissue specificity: Found in virtually all analyzed tumor cell lines including B- and T-lymphomas, neuroblastomas, melanomas and carcinomas.
• Sequence:

  MGNAESQHVEHEFYGEKHASLGRKHTSRSLRLSHKTRRTRHASSGKVIHRNSEVSTRSSSTPSIPQSLAENGLEP
  FSQDGTLEDFGSPIWVDRVDMGLRPVSYTDSSVTPSVDSSIVLTAASVQSMPDTEESRLYGDDATYLAEGGRRQH
  SYTSNGPTFMETASFKKKRSKSADIWREDSLEFSLSDLSQEHLTSNEEILGSAEEKDCEEARGMETRASPRQLST
  CQRANSLGDLYAQKNSGVTANGGPGSKFAGYCRNLVSDIPNLANHKMPPAAAEETPPYSNYNTLPCRKSHCLSEG
  ATNPQISHSNSMQGRRAKTTQDVNAGEGSEFADSGIEGATTDTDLLSRRSNATNSSYSPTTGRAFVGSDSGSSST
  GDAARQGVYENFRRELEMSTTNSESLEEAGSAHSDEQSSGTLSSPGQSDILLTAAQGTVRKAGALAVKNFLVHKK
  NKKVESATRRKWKHYWVSLKGCTLFFYESDGRSGIDHNSIPKHAVWVENSIVQAVPEHPKKDFVFCLSNSLGDAF
  LFQTTSQTELENWITAIHSACATAVARHHHKEDTLRLLKSEIKKLEQKIDMDEKMKKMGEMQLSSVTDSKKKKTI
  LDQIFVWEQNLEQFQMDLFRFRCYLASLQGGELPNPKRLLAFASRPTKVAMGRLGIFSVSSFHALVAARTGETGV
  RRRTQAMSRSASKRRSRFSSLWGLDTTSKKKQGRPSINQVFGEGTEAVKKSLEGIFDDIVPDGKREKEVVLPNVH
  QHNPDCDIWVHEYFTPSWFCLPNNQPALTVVRPGDTARDTLELICKTHQLDHSAHYLRLKFLIENKMQLYVPQPE
  EDIYELLYKEIEICPKVTQSIHIEKSDTAADTYGFSLSSVEEDGIRRLYVNSVKETGLASKKGLKAGDEILEINN
  RAADALNSSMLKDFLSQPSLGLLVRTYPELEEGVELLESPPHRVDGPADLGESPLAFLTSNPGHSLCSEQGSSAE
  TAPEETEGPDLESSDETDHSSKSTEQVAAFCRSLHEMNPSDQSPSPQDSTGPQLATMRQLSDADKLRKVICELLE
  TERTYVKDLNCLMERYLKPLQKETFLTQDELDVLFGNLTEMVEFQVEFLKTLEDGVRLVPDLEKLEKVDQFKKVL
  FSLGGSFLYYADRFKLYSAFCASHTKVPKVLVKAKTDTAFKAFLDAQNPKQQHSSTLESYLIKPIQRILKYPLLL
  RELFALTDAESEEHYHLDVAIKTMNKVASHINEMQKIHEEFGAVFDQLIAEQTGEKKEVADLSMGDLLLHTTVIW
  LNPPASLGKWKKEPELAAFVFKTAVVLVYKDGSKQKKKLVGSHRLSIYEDWDPFRFRHMIPTEALQVRALASADA
  EANAVCEIVHVKSESEGRPERVFHLCCSSPESRKDFLKAVHSILRDKHRRQLLKTESLPSSQQYVPFGGKRLCAL
  KGARPAMSRAVSAPSKSLGRRRRRLARNRFTIDSDAVSASSPEKESQQPPGGGDTDRWVEEQFDLAQYEEQDDIK
  ETDILSDDDEFCESVKGASVDRDLQERLQATSISQRERGRKTLDSHASRMAQLKKQAALSGINGGLESASEEVIW
  VRREDFAPSRKLNTEI

• Structural information:
  • Protein Domains: (434..54-)
    (/note="PH-1)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00145-)
    (765..83-)
    (/note="RBD-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00262-)
    (845..90-)
    (/note="PDZ-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00143-)
    (1-)
  • Interpro: IPR035899  IPR000219  IPR001331  IPR001478  IPR036034   IPR011993  IPR001849  IPR003116  IPR033360  IPR040655  
  • Prosite: PS00741 PS50010 PS50106 PS50003 PS50898
  • CDD: cd00160
  • PDB: 2D8I 3KZD 3KZE 4GVC 4GVD 4K2O 4K2P 4NXP 4NXQ 4NXR
  • PDBsum: 2D8I 3KZD 3KZE 4GVC 4GVD 4K2O 4K2P 4NXP 4NXQ 4NXR
  • DIP: 38309
  • STRING: ENSP00000286827
• Other Databases: GeneCards:  TIAM1  Malacards:  TIAM1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0030676	Rac guanyl-nucleotide exchange factor activity	IDA	molecular function
GO:0005829	cytosol	IDA	cellular component
GO:1904338	regulation of dopaminergic neuron differentiation	ISS	biological process
GO:0090630	activation of GTPase activity	IDA	biological process
GO:0032092	positive regulation of protein binding	IDA	biological process
GO:0005886	plasma membrane	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0019900	kinase binding	IPI	molecular function
GO:0019900	kinase binding	IPI	molecular function
GO:2000050	regulation of non-canonical Wnt signaling pathway	ISS	biological process
GO:0034622	cellular protein-containing complex assembly	IDA	biological process
GO:0060071	Wnt signaling pathway, planar cell polarity pathway	NAS	biological process
GO:0005886	plasma membrane	IBA	cellular component
GO:0007264	small GTPase mediated signal transduction	IBA	biological process
GO:0016020	membrane	IBA	cellular component
GO:0045202	synapse	IBA	cellular component
GO:0005829	cytosol	IBA	cellular component
GO:0030676	Rac guanyl-nucleotide exchange factor activity	IBA	molecular function
GO:0050772	positive regulation of axonogenesis	IBA	biological process
GO:0090630	activation of GTPase activity	IBA	biological process
GO:0005911	cell-cell junction	IDA	cellular component
GO:0044291	cell-cell contact zone	IDA	cellular component
GO:0031234	extrinsic component of cytoplasmic side of plasma membrane	IDA	cellular component
GO:0030676	Rac guanyl-nucleotide exchange factor activity	IMP	molecular function
GO:0016601	Rac protein signal transduction	IMP	biological process
GO:0016477	cell migration	IMP	biological process
GO:0007160	cell-matrix adhesion	IMP	biological process
GO:0007165	signal transduction	IEA	biological process
GO:0090630	activation of GTPase activity	IEA	biological process
GO:0005085	guanyl-nucleotide exchange factor activity	IEA	molecular function
GO:0007264	small GTPase mediated signal transduction	IEA	biological process
GO:0035556	intracellular signal transduction	IEA	biological process
GO:0030054	cell junction	IEA	cellular component
GO:0008289	lipid binding	IEA	molecular function
GO:0005886	plasma membrane	IEA	cellular component
GO:0005085	guanyl-nucleotide exchange factor activity	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0005089	Rho guanyl-nucleotide exchange factor activity	TAS	molecular function
GO:0005085	guanyl-nucleotide exchange factor activity	EXP	molecular function
GO:0007186	G protein-coupled receptor signaling pathway	TAS	biological process
GO:0043065	positive regulation of apoptotic process	TAS	biological process
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0048013	ephrin receptor signaling pathway	TAS	biological process
GO:0051056	regulation of small GTPase mediated signal transduction	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:1904268	positive regulation of Schwann cell chemotaxis	IEA	biological process
GO:0098989	NMDA selective glutamate receptor signaling pathway	IEA	biological process
GO:0098978	glutamatergic synapse	IEA	cellular component
GO:0090630	activation of GTPase activity	IEA	biological process
GO:0070372	regulation of ERK1 and ERK2 cascade	IEA	biological process
GO:0061003	positive regulation of dendritic spine morphogenesis	IEA	biological process
GO:0050772	positive regulation of axonogenesis	IEA	biological process
GO:0044304	main axon	IEA	cellular component
GO:0044295	axonal growth cone	IEA	cellular component
GO:0036477	somatodendritic compartment	IEA	cellular component
GO:0032587	ruffle membrane	IEA	cellular component
GO:0030335	positive regulation of cell migration	IEA	biological process
GO:0017016	Ras GTPase binding	IEA	molecular function
GO:0008017	microtubule binding	IEA	molecular function
GO:0005829	cytosol	IEA	cellular component
GO:1990138	neuron projection extension	IEA	biological process
GO:1905274	regulation of modification of postsynaptic actin cytoskeleton	IEA	biological process
GO:0099147	extrinsic component of postsynaptic density membrane	IEA	cellular component
GO:0072657	protein localization to membrane	IEA	biological process
GO:0061178	regulation of insulin secretion involved in cellular response to glucose stimulus	IEA	biological process
GO:0048365	Rac GTPase binding	IEA	molecular function
GO:0045202	synapse	IEA	cellular component
GO:0043507	positive regulation of JUN kinase activity	IEA	biological process
GO:0043197	dendritic spine	IEA	cellular component
GO:0043025	neuronal cell body	IEA	cellular component
GO:0042220	response to cocaine	IEA	biological process
GO:0030971	receptor tyrosine kinase binding	IEA	molecular function
GO:0014069	postsynaptic density	IEA	cellular component
GO:0010976	positive regulation of neuron projection development	IEA	biological process
GO:0006915	apoptotic process	IEA	biological process
GO:0005874	microtubule	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0003300	cardiac muscle hypertrophy	IEA	biological process
GO:0010717	regulation of epithelial to mesenchymal transition	IDA	biological process
GO:0030335	positive regulation of cell migration	IDA	biological process
GO:0008284	positive regulation of cell population proliferation	IDA	biological process
GO:0010718	positive regulation of epithelial to mesenchymal transition	NAS	biological process
GO:0030054	cell junction	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04014	Ras signaling pathway
hsa04810	Regulation of actin cytoskeleton
hsa04015	Rap1 signaling pathway
hsa04024	cAMP signaling pathway
hsa04062	Chemokine signaling pathway
hsa05205	Proteoglycans in cancer
hsa04530	Tight junction

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq