• Gene id: 7073

Gene Summary

• Gene Symbol: TIAL1   Gene   UCSC   Ensembl
• Aliases: TCBP, TIAR
• Gene name: TIA1 cytotoxic granule associated RNA binding protein like 1
• Alternate names: nucleolysin TIAR, T-cluster binding protein, TIA-1-related nucleolysin, TIA1 related, aging-associated gene 7 protein,
• Gene location: 10q26.11 (119598840: 119573464)     Exons: 16     NC_000010.11
• Gene summary(Entrez): The protein encoded by this gene is a member of a family of RNA-binding proteins, has three RNA recognition motifs (RRMs), and binds adenine and uridine-rich elements in mRNA and pre-mRNAs of a wide range of genes. It regulates various activities includin
• OMIM: 603413

Protein Summary

• Protein general information: Q01085  
  • Name: Nucleolysin TIAR (TIA 1 related protein)
  • Length: 375  
  • Mass: 41591
• Sequence:

  MMEDDGQPRTLYVGNLSRDVTEVLILQLFSQIGPCKSCKMITEHTSNDPYCFVEFYEHRDAAAALAAMNGRKILG
  KEVKVNWATTPSSQKKDTSNHFHVFVGDLSPEITTEDIKSAFAPFGKISDARVVKDMATGKSKGYGFVSFYNKLD
  AENAIVHMGGQWLGGRQIRTNWATRKPPAPKSTQENNTKQLRFEDVVNQSSPKNCTVYCGGIASGLTDQLMRQTF
  SPFGQIMEIRVFPEKGYSFVRFSTHESAAHAIVSVNGTTIEGHVVKCYWGKESPDMTKNFQQVDYSQWGQWSQVY
  GNPQQYGQYMANGWQVPPYGVYGQPWNQQGFGVDQSPSAAWMGGFGAQPPQGQAPPPVIPPPNQAGYGMASYQTQ

• Structural information:
  • Protein Domains: (9..8-)
    (/note="RRM-1)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00176-)
    (97..17-)
    (/note="RRM-2)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00176-)
    (205..27-)
    (/note="RRM-3)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00176"-)
  • Interpro: IPR012677  IPR035979  IPR000504  IPR003954  IPR034492   IPR034494  IPR034496  
  • Prosite: PS50102
  • CDD: cd12616 cd12617 cd12620
  • PDB: 1X4G 2CQI 2DH7
  • PDBsum: 1X4G 2CQI 2DH7
  • DIP: 42425
  • STRING: ENSP00000358089
• Other Databases: GeneCards:  TIAL1  Malacards:  TIAL1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0010494	cytoplasmic stress granule	ISS	cellular component
GO:0005737	cytoplasm	ISS	cellular component
GO:0005634	nucleus	ISS	cellular component
GO:0003676	nucleic acid binding	IEA	molecular function
GO:0003677	DNA binding	IEA	molecular function
GO:0003723	RNA binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0006915	apoptotic process	IEA	biological process
GO:0003723	RNA binding	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0003723	RNA binding	TAS	molecular function
GO:0006915	apoptotic process	TAS	biological process
GO:0005764	lysosome	TAS	cellular component
GO:0006357	regulation of transcription by RNA polymerase II	TAS	biological process
GO:0006952	defense response	TAS	biological process
GO:0008543	fibroblast growth factor receptor signaling pathway	TAS	biological process
GO:0005654	nucleoplasm	TAS	cellular component
GO:1990904	ribonucleoprotein complex	IEA	cellular component
GO:0010494	cytoplasmic stress granule	IEA	cellular component
GO:0035925	mRNA 3'-UTR AU-rich region binding	IEA	molecular function
GO:0017145	stem cell division	IEA	biological process
GO:0010494	cytoplasmic stress granule	IEA	cellular component
GO:0008284	positive regulation of cell population proliferation	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0007281	germ cell development	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0010494	cytoplasmic stress granule	ISS	cellular component
GO:0005634	nucleus	ISS	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0003723	RNA binding	HDA	molecular function
GO:0003723	RNA binding	HDA	molecular function

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)