• Gene id: 7071

Gene Summary

• Gene Symbol: KLF10   Gene   UCSC   Ensembl
• Aliases: EGR-alpha, EGRA, TIEG, TIEG1
• Gene name: Kruppel like factor 10
• Alternate names: Krueppel-like factor 10, TGFB-inducible early growth response protein 1, early growth response-alpha, transforming growth factor-beta-inducible early growth response protein 1, zinc finger transcription factor TIEG,
• Gene location: 8q22.3 (102655724: 102648776)     Exons: 5     NC_000008.11
• Gene summary(Entrez): This gene encodes a member of a family of proteins that feature C2H2-type zinc finger domains. The encoded protein is a transcriptional repressor that acts as an effector of transforming growth factor beta signaling. Activity of this protein may inhibit t
• OMIM: 0

Protein Summary

• Protein general information: Q13118  
  • Name: Krueppel like factor 10 (EGR alpha) (Transforming growth factor beta inducible early growth response protein 1) (TGFB inducible early growth response protein 1) (TIEG 1)
  • Length: 480  
  • Mass: 52555
• Sequence:

  MLNFGASLQQTAEERMEMISERPKESMYSWNKTAEKSDFEAVEALMSMSCSWKSDFKKYVENRPVTPVSDLSEEE
  NLLPGTPDFHTIPAFCLTPPYSPSDFEPSQVSNLMAPAPSTVHFKSLSDTAKPHIAAPFKEEEKSPVSAPKLPKA
  QATSVIRHTADAQLCNHQTCPMKAASILNYQNNSFRRRTHLNVEAARKNIPCAAVSPNRSKCERNTVADVDEKAS
  AALYDFSVPSSETVICRSQPAPVSPQQKSVLVSPPAVSAGGVPPMPVICQMVPLPANNPVVTTVVPSTPPSQPPA
  VCPPVVFMGTQVPKGAVMFVVPQPVVQSSKPPVVSPNGTRLSPIAPAPGFSPSAAKVTPQIDSSRIRSHICSHPG
  CGKTYFKSSHLKAHTRTHTGEKPFSCSWKGCERRFARSDELSRHRRTHTGEKKFACPMCDRRFMRSDHLTKHARR
  HLSAKKLPNWQMEVSKLNDIALPPTPAPTQ

• Structural information:
  • Interpro: IPR036236  IPR013087  
  • Prosite: PS00028 PS50157
  • PDB: 2EPA
  • PDBsum: 2EPA
  • STRING: ENSP00000285407
• Other Databases: GeneCards:  KLF10  Malacards:  KLF10

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0001228	DNA-binding transcription activator activity, RNA polymerase II-specific	IDA	molecular function
GO:0000978	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IDA	molecular function
GO:0045944	positive regulation of transcription by RNA polymerase II	IDA	biological process
GO:0000790	nuclear chromatin	ISA	cellular component
GO:0000981	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA	molecular function
GO:0000976	transcription regulatory region sequence-specific DNA binding	IBA	molecular function
GO:0000981	DNA-binding transcription factor activity, RNA polymerase II-specific	IBA	molecular function
GO:0005634	nucleus	IBA	cellular component
GO:0045944	positive regulation of transcription by RNA polymerase II	IBA	biological process
GO:0001046	core promoter sequence-specific DNA binding	ISS	molecular function
GO:0045892	negative regulation of transcription, DNA-templated	ISS	biological process
GO:0042752	regulation of circadian rhythm	ISS	biological process
GO:0005634	nucleus	ISS	cellular component
GO:0009267	cellular response to starvation	ISS	biological process
GO:0046872	metal ion binding	IEA	molecular function
GO:0048511	rhythmic process	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0003677	DNA binding	IEA	molecular function
GO:0003700	DNA-binding transcription factor activity	TAS	molecular function
GO:0000122	negative regulation of transcription by RNA polymerase II	TAS	biological process
GO:0005634	nucleus	TAS	cellular component
GO:0007267	cell-cell signaling	TAS	biological process
GO:0008285	negative regulation of cell population proliferation	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0045892	negative regulation of transcription, DNA-templated	IEA	biological process
GO:0045672	positive regulation of osteoclast differentiation	IEA	biological process
GO:0001046	core promoter sequence-specific DNA binding	IEA	molecular function
GO:1901653	cellular response to peptide	IEA	biological process
GO:0042752	regulation of circadian rhythm	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0035019	somatic stem cell population maintenance	IEA	biological process
GO:0030282	bone mineralization	IEA	biological process
GO:0009267	cellular response to starvation	IEA	biological process
GO:0007623	circadian rhythm	IEA	biological process
GO:0006355	regulation of transcription, DNA-templated	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881