• Gene id: 7070

Gene Summary

• Gene Symbol: THY1   Gene   UCSC   Ensembl
• Aliases: CD90, CDw90
• Gene name: Thy-1 cell surface antigen
• Alternate names: thy-1 membrane glycoprotein, Thy-1 T-cell antigen, thy-1 antigen,
• Gene location: 11q23.3 (119424984: 119415475)     Exons: 7     NC_000011.10
• Gene summary(Entrez): This gene encodes a cell surface glycoprotein and member of the immunoglobulin superfamily of proteins. The encoded protein is involved in cell adhesion and cell communication in numerous cell types, but particularly in cells of the immune and nervous sys
• OMIM: 610625

Protein Summary

• Protein general information: P04216  
  • Name: Thy 1 membrane glycoprotein (CDw90) (Thy 1 antigen) (CD antigen CD90)
  • Length: 161  
  • Mass: 17935
• Sequence:

  MNLAISIALLLTVLQVSRGQKVTSLTACLVDQSLRLDCRHENTSSSPIQYEFSLTRETKKHVLFGTVGVPEHTYR
  SRTNFTSKYNMKVLYLSAFTSKDEGTYTCALHHSGHSPPISSQNVTVLRDKLVKCEGISLLAQNTSWLLLLLLSL
  SLLQATDFMSL

• Structural information:
  • Protein Domains: (20..12-)
    (/note="Ig-like-V-type")
  • Interpro: IPR007110  IPR036179  IPR013783  IPR013106  IPR013151   IPR033292  
  • Prosite: PS50835
  • STRING: ENSP00000284240
• Other Databases: GeneCards:  THY1  Malacards:  THY1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0050771	negative regulation of axonogenesis	IBA	biological process
GO:0048041	focal adhesion assembly	IBA	biological process
GO:0045121	membrane raft	IBA	cellular component
GO:0034235	GPI anchor binding	IBA	molecular function
GO:0030425	dendrite	IBA	cellular component
GO:0030336	negative regulation of cell migration	IBA	biological process
GO:0007010	cytoskeleton organization	IBA	biological process
GO:0001525	angiogenesis	IBA	biological process
GO:0051281	positive regulation of release of sequestered calcium ion into cytosol	IBA	biological process
GO:0050870	positive regulation of T cell activation	IBA	biological process
GO:0050852	T cell receptor signaling pathway	IBA	biological process
GO:0046549	retinal cone cell development	IBA	biological process
GO:0043547	positive regulation of GTPase activity	IBA	biological process
GO:0031362	anchored component of external side of plasma membrane	IBA	cellular component
GO:0019901	protein kinase binding	IBA	molecular function
GO:0006469	negative regulation of protein kinase activity	IBA	biological process
GO:0005178	integrin binding	IBA	molecular function
GO:0005096	GTPase activator activity	IBA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0030334	regulation of cell migration	IEA	biological process
GO:0005178	integrin binding	IEA	molecular function
GO:0007155	cell adhesion	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0031225	anchored component of membrane	IEA	cellular component
GO:0005887	integral component of plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005783	endoplasmic reticulum	IDA	cellular component
GO:0070571	negative regulation of neuron projection regeneration	IEA	biological process
GO:0061099	negative regulation of protein tyrosine kinase activity	IEA	biological process
GO:0051281	positive regulation of release of sequestered calcium ion into cytosol	IEA	biological process
GO:0050870	positive regulation of T cell activation	IEA	biological process
GO:0050852	T cell receptor signaling pathway	IEA	biological process
GO:0043547	positive regulation of GTPase activity	IEA	biological process
GO:0043113	receptor clustering	IEA	biological process
GO:0032809	neuronal cell body membrane	IEA	cellular component
GO:0032590	dendrite membrane	IEA	cellular component
GO:0030426	growth cone	IEA	cellular component
GO:0019901	protein kinase binding	IEA	molecular function
GO:0019899	enzyme binding	IEA	molecular function
GO:0009986	cell surface	IEA	cellular component
GO:0006469	negative regulation of protein kinase activity	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0005096	GTPase activator activity	IEA	molecular function
GO:2000298	regulation of Rho-dependent protein serine/threonine kinase activity	IEA	biological process
GO:0070571	negative regulation of neuron projection regeneration	IEA	biological process
GO:0051894	positive regulation of focal adhesion assembly	IEA	biological process
GO:0050860	negative regulation of T cell receptor signaling pathway	IEA	biological process
GO:0046549	retinal cone cell development	IEA	biological process
GO:0031362	anchored component of external side of plasma membrane	IEA	cellular component
GO:0009897	external side of plasma membrane	IEA	cellular component
GO:0005178	integrin binding	IEA	molecular function
GO:0098609	cell-cell adhesion	IEA	biological process
GO:0050771	negative regulation of axonogenesis	IEA	biological process
GO:0048041	focal adhesion assembly	IEA	biological process
GO:0046777	protein autophosphorylation	IEA	biological process
GO:0046658	anchored component of plasma membrane	IEA	cellular component
GO:0045121	membrane raft	IEA	cellular component
GO:0034235	GPI anchor binding	IEA	molecular function
GO:0030673	axolemma	IEA	cellular component
GO:0030336	negative regulation of cell migration	IEA	biological process
GO:0007267	cell-cell signaling	IEA	biological process
GO:0007010	cytoskeleton organization	IEA	biological process
GO:0005829	cytosol	IEA	cellular component
GO:0045121	membrane raft	IEA	cellular component
GO:0030425	dendrite	IEA	cellular component
GO:0007267	cell-cell signaling	IEA	biological process
GO:0007229	integrin-mediated signaling pathway	IEA	biological process
GO:0001525	angiogenesis	IEA	biological process
GO:0016324	apical plasma membrane	IDA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0002693	positive regulation of cellular extravasation	IDA	biological process
GO:0034116	positive regulation of heterotypic cell-cell adhesion	IDA	biological process
GO:0009986	cell surface	IDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0007229	integrin-mediated signaling pathway	IMP	biological process
GO:0050771	negative regulation of axonogenesis	ISS	biological process
GO:0034235	GPI anchor binding	ISS	molecular function
GO:0098609	cell-cell adhesion	ISS	biological process
GO:0001525	angiogenesis	ISS	biological process
GO:0070571	negative regulation of neuron projection regeneration	ISS	biological process
GO:0061099	negative regulation of protein tyrosine kinase activity	ISS	biological process
GO:0051894	positive regulation of focal adhesion assembly	IMP	biological process
GO:0032590	dendrite membrane	ISS	cellular component
GO:0001952	regulation of cell-matrix adhesion	IMP	biological process
GO:0005925	focal adhesion	HDA	cellular component
GO:0051281	positive regulation of release of sequestered calcium ion into cytosol	ISS	biological process
GO:0050860	negative regulation of T cell receptor signaling pathway	ISS	biological process
GO:0030426	growth cone	ISS	cellular component
GO:0006469	negative regulation of protein kinase activity	ISS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005178	integrin binding	IPI	molecular function
GO:0030673	axolemma	ISS	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0048041	focal adhesion assembly	ISS	biological process
GO:0045121	membrane raft	NAS	cellular component
GO:0030336	negative regulation of cell migration	ISS	biological process
GO:0007010	cytoskeleton organization	ISS	biological process
GO:2000298	regulation of Rho-dependent protein serine/threonine kinase activity	ISS	biological process
GO:0043113	receptor clustering	ISS	biological process
GO:0032809	neuronal cell body membrane	ISS	cellular component
GO:0005178	integrin binding	IMP	molecular function
GO:0050870	positive regulation of T cell activation	ISS	biological process
GO:0050852	T cell receptor signaling pathway	ISS	biological process
GO:0046549	retinal cone cell development	ISS	biological process
GO:0043547	positive regulation of GTPase activity	ISS	biological process
GO:0009897	external side of plasma membrane	ISS	cellular component
GO:0005886	plasma membrane	ISS	cellular component
GO:0005096	GTPase activator activity	ISS	molecular function
GO:0007267	cell-cell signaling	ISS	biological process
GO:0070571	negative regulation of neuron projection regeneration	ISS	biological process

KEGG pathways

Pathway id	Pathway name
hsa04670	Leukocyte transendothelial migration

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq