• Gene id: 7067

Gene Summary

• Gene Symbol: THRA   Gene   UCSC   Ensembl
• Aliases: AR7, CHNG6, EAR7, ERB-T-1, ERBA, ERBA1, NR1A1, THRA1, THRA2, c-ERBA-1
• Gene name: thyroid hormone receptor alpha
• Alternate names: thyroid hormone receptor alpha, EAR-7, ERBA-related 7, V-erbA-related protein 7, c-erbA-alpha, nuclear receptor subfamily 1 group A member 1, thyroid hormone receptor alpha 1, thyroid hormone receptor, alpha (erythroblastic leukemia viral (v-erb-a) oncogene homo,
• Gene location: 17q21.1 (40062192: 40093866)     Exons: 11     NC_000017.11
• Gene summary(Entrez): The protein encoded by this gene is a nuclear hormone receptor for triiodothyronine. It is one of the several receptors for thyroid hormone, and has been shown to mediate the biological activities of thyroid hormone. Knockout studies in mice suggest that
• OMIM: 600190

Protein Summary

• Protein general information: P10827  
  • Name: Thyroid hormone receptor alpha (Nuclear receptor subfamily 1 group A member 1) (V erbA related protein 7) (EAR 7) (c erbA 1) (c erbA alpha)
  • Length: 490  
  • Mass: 54816
• Sequence:

  MEQKPSKVECGSDPEENSARSPDGKRKRKNGQCSLKTSMSGYIPSYLDKDEQCVVCGDKATGYHYRCITCEGCKG
  FFRRTIQKNLHPTYSCKYDSCCVIDKITRNQCQLCRFKKCIAVGMAMDLVLDDSKRVAKRKLIEQNRERRRKEEM
  IRSLQQRPEPTPEEWDLIHIATEAHRSTNAQGSHWKQRRKFLPDDIGQSPIVSMPDGDKVDLEAFSEFTKIITPA
  ITRVVDFAKKLPMFSELPCEDQIILLKGCCMEIMSLRAAVRYDPESDTLTLSGEMAVKREQLKNGGLGVVSDAIF
  ELGKSLSAFNLDDTEVALLQAVLLMSTDRSGLLCVDKIEKSQEAYLLAFEHYVNHRKHNIPHFWPKLLMKEREVQ
  SSILYKGAAAEGRPGGSLGVHPEGQQLLGMHVVQGPQVRQLEQQLGEAGSLQGPVLQHQSPKSPQQRLLELLHRS
  GILHARAVCGEDDSSEADSPSSSEEEPEVCEDLAGNAASP

• Structural information:
  • Protein Domains: (163..40-)
    (/note="NR-LBD)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU01189"-)
  • Interpro: IPR035500  IPR000536  IPR001723  IPR001728  IPR001628   IPR013088  
  • Prosite: PS51843 PS00031 PS51030
  • PDB: 1NAV 2H77 2H79 3HZF 3ILZ 3JZB 4LNW 4LNX
  • PDBsum: 1NAV 2H77 2H79 3HZF 3ILZ 3JZB 4LNW 4LNX
  • DIP: 31452
  • STRING: ENSP00000264637
• Other Databases: GeneCards:  THRA  Malacards:  THRA

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0004879	nuclear receptor activity	IDA	molecular function
GO:0000981	DNA-binding transcription factor activity, RNA polymerase II-specific	ISM	molecular function
GO:0000790	nuclear chromatin	ISA	cellular component
GO:0000981	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA	molecular function
GO:0045944	positive regulation of transcription by RNA polymerase II	IBA	biological process
GO:0000122	negative regulation of transcription by RNA polymerase II	IBA	biological process
GO:0000977	RNA polymerase II transcription regulatory region sequence-specific DNA binding	IBA	molecular function
GO:0008134	transcription factor binding	IBA	molecular function
GO:0030154	cell differentiation	IBA	biological process
GO:0038023	signaling receptor activity	IBA	molecular function
GO:0090575	RNA polymerase II transcription regulator complex	IBA	cellular component
GO:0002154	thyroid hormone mediated signaling pathway	IBA	biological process
GO:0004879	nuclear receptor activity	IBA	molecular function
GO:0009755	hormone-mediated signaling pathway	IBA	biological process
GO:0004879	nuclear receptor activity	IDA	molecular function
GO:0070324	thyroid hormone binding	IDA	molecular function
GO:0003700	DNA-binding transcription factor activity	IEA	molecular function
GO:0003707	steroid hormone receptor activity	IEA	molecular function
GO:0004879	nuclear receptor activity	IEA	molecular function
GO:0008270	zinc ion binding	IEA	molecular function
GO:0042025	host cell nucleus	IEA	cellular component
GO:0043565	sequence-specific DNA binding	IEA	molecular function
GO:0003677	DNA binding	IEA	molecular function
GO:0006355	regulation of transcription, DNA-templated	IEA	biological process
GO:0046872	metal ion binding	IEA	molecular function
GO:0003677	DNA binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0070324	thyroid hormone binding	IPI	molecular function
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0006367	transcription initiation from RNA polymerase II promoter	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0120162	positive regulation of cold-induced thermogenesis	IEA	biological process
GO:0060509	type I pneumocyte differentiation	IEA	biological process
GO:0050994	regulation of lipid catabolic process	IEA	biological process
GO:0045944	positive regulation of transcription by RNA polymerase II	IEA	biological process
GO:0045925	positive regulation of female receptivity	IEA	biological process
GO:0044877	protein-containing complex binding	IEA	molecular function
GO:0031490	chromatin DNA binding	IEA	molecular function
GO:0009409	response to cold	IEA	biological process
GO:0008050	female courtship behavior	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0002155	regulation of thyroid hormone mediated signaling pathway	IEA	biological process
GO:0001502	cartilage condensation	IEA	biological process
GO:0045892	negative regulation of transcription, DNA-templated	IEA	biological process
GO:0033032	regulation of myeloid cell apoptotic process	IEA	biological process
GO:0030878	thyroid gland development	IEA	biological process
GO:0030218	erythrocyte differentiation	IEA	biological process
GO:0009887	animal organ morphogenesis	IEA	biological process
GO:0008016	regulation of heart contraction	IEA	biological process
GO:0007611	learning or memory	IEA	biological process
GO:0004879	nuclear receptor activity	IEA	molecular function
GO:0001503	ossification	IEA	biological process
GO:0000976	transcription regulatory region sequence-specific DNA binding	IEA	molecular function
GO:0003700	DNA-binding transcription factor activity	IDA	molecular function
GO:0000976	transcription regulatory region sequence-specific DNA binding	IDA	molecular function
GO:0006357	regulation of transcription by RNA polymerase II	IDA	biological process
GO:0009755	hormone-mediated signaling pathway	IDA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0120162	positive regulation of cold-induced thermogenesis	ISS	biological process
GO:0043401	steroid hormone mediated signaling pathway	IEA	biological process
GO:0006366	transcription by RNA polymerase II	IDA	biological process
GO:0005829	cytosol	IDA	cellular component
GO:0003700	DNA-binding transcription factor activity	IDA	molecular function
GO:0070324	thyroid hormone binding	IDA	molecular function
GO:0005634	nucleus	IDA	cellular component
GO:0045892	negative regulation of transcription, DNA-templated	IDA	biological process
GO:0017025	TBP-class protein binding	IDA	molecular function
GO:0006366	transcription by RNA polymerase II	IDA	biological process
GO:0004879	nuclear receptor activity	IDA	molecular function
GO:0003700	DNA-binding transcription factor activity	IDA	molecular function
GO:2000143	negative regulation of DNA-templated transcription, initiation	IDA	biological process
GO:0017055	negative regulation of RNA polymerase II transcription preinitiation complex assembly	IDA	biological process
GO:0005634	nucleus	IDA	cellular component
GO:0019904	protein domain specific binding	IPI	molecular function
GO:0008134	transcription factor binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function

KEGG pathways

Pathway id	Pathway name
hsa04080	Neuroactive ligand-receptor interaction
hsa04919	Thyroid hormone signaling pathway

Diseases

Associated diseases	References
Congenital nongoitrous hypothyroidism	KEGG:H00250
Congenital nongoitrous hypothyroidism	KEGG:H00250
Breast cancer	PMID:12082618
renal cell carcinoma	PMID:11756220
Cryptorchidism	MIK: 28606200
Spermatogenic defects	MIK: 31037746

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R