• Gene id: 7066

Gene Summary

• Gene Symbol: THPO   Gene   UCSC   Ensembl
• Aliases: MGDF, MKCSF, ML, MPLLG, THCYT1, TPO
• Gene name: thrombopoietin
• Alternate names: thrombopoietin, MPL ligand, c-mpl ligand, megakaryocyte colony-stimulating factor, megakaryocyte growth and development factor, megakaryocyte stimulating factor, myeloproliferative leukemia virus oncogene ligand, prepro-thrombopoietin,
• Gene location: 3q27.1 (184379687: 184371934)     Exons: 7     NC_000003.12
• Gene summary(Entrez): Megakaryocytopoiesis is the cellular development process that leads to platelet production. The main functional protein encoded by this gene is a humoral growth factor that is necessary for megakaryocyte proliferation and maturation, as well as for thromb

Protein Summary

• Protein general information: P40225  
  • Name: Thrombopoietin (C mpl ligand) (ML) (Megakaryocyte colony stimulating factor) (Megakaryocyte growth and development factor) (MGDF) (Myeloproliferative leukemia virus oncogene ligand)
  • Length: 353  
  • Mass: 37823
• Sequence:

  MELTELLLVVMLLLTARLTLSSPAPPACDLRVLSKLLRDSHVLHSRLSQCPEVHPLPTPVLLPAVDFSLGEWKTQ
  MEETKAQDILGAVTLLLEGVMAARGQLGPTCLSSLLGQLSGQVRLLLGALQSLLGTQLPPQGRTTAHKDPNAIFL
  SFQHLLRGKVRFLMLVGGSTLCVRRAPPTTAVPSRTSLVLTLNELPNRTSGLLETNFTASARTTGSGLLKWQQGF
  RAKIPGLLNQTSRSLDQIPGYLNRIHELLNGTRGLFPGPSRRTLGAPDISSGTSDTGSLPPNLQPGYSPSPTHPP
  TGQYTLFPLPPTLPTPVVQLHPLLPDPSAPTPTPTSPLLNTSYTHSQNLSQEG

• Structural information:
  • Interpro: IPR009079  IPR019767  IPR001323  IPR003978  
  • Prosite: PS00817
  • PDB: 1V7M 1V7N
  • PDBsum: 1V7M 1V7N
  • DIP: 5729
  • STRING: ENSP00000204615
• Other Databases: GeneCards:  THPO  Malacards:  THPO

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0097696	receptor signaling pathway via STAT	IDA	biological process
GO:0035855	megakaryocyte development	IDA	biological process
GO:0043410	positive regulation of MAPK cascade	IDA	biological process
GO:0038163	thrombopoietin-mediated signaling pathway	IDA	biological process
GO:0008284	positive regulation of cell population proliferation	IDA	biological process
GO:0051897	positive regulation of protein kinase B signaling	IDA	biological process
GO:1902035	positive regulation of hematopoietic stem cell proliferation	IBA	biological process
GO:0038163	thrombopoietin-mediated signaling pathway	IBA	biological process
GO:0008284	positive regulation of cell population proliferation	IBA	biological process
GO:0005576	extracellular region	IBA	cellular component
GO:0070374	positive regulation of ERK1 and ERK2 cascade	IBA	biological process
GO:0005102	signaling receptor binding	IBA	molecular function
GO:0038163	thrombopoietin-mediated signaling pathway	ISS	biological process
GO:0070374	positive regulation of ERK1 and ERK2 cascade	ISS	biological process
GO:0051897	positive regulation of protein kinase B signaling	ISS	biological process
GO:0045654	positive regulation of megakaryocyte differentiation	ISS	biological process
GO:0001934	positive regulation of protein phosphorylation	ISS	biological process
GO:0005125	cytokine activity	IEA	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0005179	hormone activity	IEA	molecular function
GO:0008283	cell population proliferation	IEA	biological process
GO:0005125	cytokine activity	IEA	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0005615	extracellular space	IEA	cellular component
GO:0005179	hormone activity	IEA	molecular function
GO:0008083	growth factor activity	TAS	molecular function
GO:0007275	multicellular organism development	TAS	biological process
GO:0008283	cell population proliferation	TAS	biological process
GO:1902035	positive regulation of hematopoietic stem cell proliferation	IDA	biological process
GO:0070374	positive regulation of ERK1 and ERK2 cascade	IEA	biological process
GO:0051897	positive regulation of protein kinase B signaling	IEA	biological process
GO:0045654	positive regulation of megakaryocyte differentiation	IEA	biological process
GO:0001934	positive regulation of protein phosphorylation	IEA	biological process
GO:0038163	thrombopoietin-mediated signaling pathway	IEA	biological process
GO:0030099	myeloid cell differentiation	IEA	biological process
GO:0005576	extracellular region	IEA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04060	Cytokine-cytokine receptor interaction
hsa04630	JAK-STAT signaling pathway
hsa04640	Hematopoietic cell lineage

Diseases

Associated diseases	References
aplastic anemia	PMID:24085763
Essential thrombocythemia	PMID:9425899
Essential thrombocythemia	PMID:9425899
Thrombocytosis	PMID:9694695
Arteriosclerosis obliterans	PMID:10822072
Pulmonary hypertension	PMID:12487786
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq