• Gene id: 7057

Gene Summary

• Gene Symbol: THBS1   Gene   UCSC   Ensembl
• Aliases: THBS, THBS-1, TSP, TSP-1, TSP1
• Gene name: thrombospondin 1
• Alternate names: thrombospondin-1, glycoprotein G, thrombospondin-1p180, thrombospondin-p50,
• Gene location: 15q14 (39581078: 39599465)     Exons: 22     NC_000015.10
• Gene summary(Entrez): The protein encoded by this gene is a subunit of a disulfide-linked homotrimeric protein. This protein is an adhesive glycoprotein that mediates cell-to-cell and cell-to-matrix interactions. This protein can bind to fibrinogen, fibronectin, laminin, type
• OMIM: 188060

Protein Summary

• Protein general information: P07996  
  • Name: Thrombospondin 1 (Glycoprotein G)
  • Length: 1170  
  • Mass: 129383
• Sequence:

  MGLAWGLGVLFLMHVCGTNRIPESGGDNSVFDIFELTGAARKGSGRRLVKGPDPSSPAFRIEDANLIPPVPDDKF
  QDLVDAVRAEKGFLLLASLRQMKKTRGTLLALERKDHSGQVFSVVSNGKAGTLDLSLTVQGKQHVVSVEEALLAT
  GQWKSITLFVQEDRAQLYIDCEKMENAELDVPIQSVFTRDLASIARLRIAKGGVNDNFQGVLQNVRFVFGTTPED
  ILRNKGCSSSTSVLLTLDNNVVNGSSPAIRTNYIGHKTKDLQAICGISCDELSSMVLELRGLRTIVTTLQDSIRK
  VTEENKELANELRRPPLCYHNGVQYRNNEEWTVDSCTECHCQNSVTICKKVSCPIMPCSNATVPDGECCPRCWPS
  DSADDGWSPWSEWTSCSTSCGNGIQQRGRSCDSLNNRCEGSSVQTRTCHIQECDKRFKQDGGWSHWSPWSSCSVT
  CGDGVITRIRLCNSPSPQMNGKPCEGEARETKACKKDACPINGGWGPWSPWDICSVTCGGGVQKRSRLCNNPTPQ
  FGGKDCVGDVTENQICNKQDCPIDGCLSNPCFAGVKCTSYPDGSWKCGACPPGYSGNGIQCTDVDECKEVPDACF
  NHNGEHRCENTDPGYNCLPCPPRFTGSQPFGQGVEHATANKQVCKPRNPCTDGTHDCNKNAKCNYLGHYSDPMYR
  CECKPGYAGNGIICGEDTDLDGWPNENLVCVANATYHCKKDNCPNLPNSGQEDYDKDGIGDACDDDDDNDKIPDD
  RDNCPFHYNPAQYDYDRDDVGDRCDNCPYNHNPDQADTDNNGEGDACAADIDGDGILNERDNCQYVYNVDQRDTD
  MDGVGDQCDNCPLEHNPDQLDSDSDRIGDTCDNNQDIDEDGHQNNLDNCPYVPNANQADHDKDGKGDACDHDDDN
  DGIPDDKDNCRLVPNPDQKDSDGDGRGDACKDDFDHDSVPDIDDICPENVDISETDFRRFQMIPLDPKGTSQNDP
  NWVVRHQGKELVQTVNCDPGLAVGYDEFNAVDFSGTFFINTERDDDYAGFVFGYQSSSRFYVVMWKQVTQSYWDT
  NPTRAQGYSGLSVKVVNSTTGPGEHLRNALWHTGNTPGQVRTLWHDPRHIGWKDFTAYRWRLSHRPKTGFIRVVM
  YEGKKIMADSGPIYDKTYAGGRLGLFVFSQEMVFFSDLKYECRDP

• Structural information:
  • Protein Domains: (65..27-)
    (/note="Laminin-G-like)
    (316..37-)
    (/note="VWFC-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00220-)
    (379..42-)
    1 (/note="TSP-type-1)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00210-)
    (435..49-)
    2 (/note="TSP-type-1)
    (-)
  • Interpro: IPR013320  IPR001881  IPR013032  IPR000742  IPR001791   IPR028499  IPR003367  IPR017897  IPR008859  IPR000884  IPR036383  IPR028974  IPR001007  
  • Prosite: PS01186 PS50026 PS50092 PS51234 PS51236 PS01208 PS50184
  • PDB: 1LSL 1UX6 1Z78 1ZA4 2ERF 2ES3 2OUH 2OUJ 3R6B 5FOE
  • PDBsum: 1LSL 1UX6 1Z78 1ZA4 2ERF 2ES3 2OUH 2OUJ 3R6B 5FOE
  • DIP: 1037
  • STRING: ENSP00000260356
• Other Databases: GeneCards:  THBS1  Malacards:  THBS1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0006954	inflammatory response	IDA	biological process
GO:0016525	negative regulation of angiogenesis	IBA	biological process
GO:0062023	collagen-containing extracellular matrix	IBA	cellular component
GO:0016529	sarcoplasmic reticulum	ISS	cellular component
GO:0005783	endoplasmic reticulum	ISS	cellular component
GO:0048266	behavioral response to pain	ISS	biological process
GO:0034976	response to endoplasmic reticulum stress	ISS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005509	calcium ion binding	IEA	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0005615	extracellular space	IEA	cellular component
GO:0016525	negative regulation of angiogenesis	IEA	biological process
GO:0050840	extracellular matrix binding	IEA	molecular function
GO:0006954	inflammatory response	IEA	biological process
GO:0007155	cell adhesion	IEA	biological process
GO:0008201	heparin binding	IEA	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0006986	response to unfolded protein	IEA	biological process
GO:0016529	sarcoplasmic reticulum	IEA	cellular component
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0008201	heparin binding	IEA	molecular function
GO:0007155	cell adhesion	IEA	biological process
GO:2001027	negative regulation of endothelial cell chemotaxis	IDA	biological process
GO:0016525	negative regulation of angiogenesis	IDA	biological process
GO:0001953	negative regulation of cell-matrix adhesion	IDA	biological process
GO:0001937	negative regulation of endothelial cell proliferation	IDA	biological process
GO:0010751	negative regulation of nitric oxide mediated signal transduction	IDA	biological process
GO:0008201	heparin binding	IDA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0002576	platelet degranulation	TAS	biological process
GO:0030198	extracellular matrix organization	TAS	biological process
GO:0031093	platelet alpha granule lumen	TAS	cellular component
GO:0031093	platelet alpha granule lumen	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005788	endoplasmic reticulum lumen	TAS	cellular component
GO:0005788	endoplasmic reticulum lumen	TAS	cellular component
GO:0005788	endoplasmic reticulum lumen	TAS	cellular component
GO:0045652	regulation of megakaryocyte differentiation	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0071363	cellular response to growth factor stimulus	IEA	biological process
GO:0071356	cellular response to tumor necrosis factor	IEA	biological process
GO:0050431	transforming growth factor beta binding	IEA	molecular function
GO:0016525	negative regulation of angiogenesis	IEA	biological process
GO:0009612	response to mechanical stimulus	IEA	biological process
GO:0005615	extracellular space	IEA	cellular component
GO:0033574	response to testosterone	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0071636	positive regulation of transforming growth factor beta production	IEA	biological process
GO:0017134	fibroblast growth factor binding	IDA	molecular function
GO:0070052	collagen V binding	IDA	molecular function
GO:0005509	calcium ion binding	NAS	molecular function
GO:0050431	transforming growth factor beta binding	ISS	molecular function
GO:0050431	transforming growth factor beta binding	TAS	molecular function
GO:0001968	fibronectin binding	IDA	molecular function
GO:0008201	heparin binding	IDA	molecular function
GO:0030169	low-density lipoprotein particle binding	IDA	molecular function
GO:0043236	laminin binding	IDA	molecular function
GO:0070051	fibrinogen binding	IDA	molecular function
GO:0005178	integrin binding	IMP	molecular function
GO:0005178	integrin binding	IMP	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0042802	identical protein binding	NAS	molecular function
GO:0043394	proteoglycan binding	TAS	molecular function
GO:0005201	extracellular matrix structural constituent	ISS	molecular function
GO:0005201	extracellular matrix structural constituent	RCA	molecular function
GO:0005201	extracellular matrix structural constituent	HDA	molecular function
GO:0005201	extracellular matrix structural constituent	RCA	molecular function
GO:0005201	extracellular matrix structural constituent	RCA	molecular function
GO:0001937	negative regulation of endothelial cell proliferation	IDA	biological process
GO:0001953	negative regulation of cell-matrix adhesion	IDA	biological process
GO:0002581	negative regulation of antigen processing and presentation of peptide or polysaccharide antigen via MHC class II	IDA	biological process
GO:0002605	negative regulation of dendritic cell antigen processing and presentation	IDA	biological process
GO:0005577	fibrinogen complex	IDA	cellular component
GO:0005615	extracellular space	IDA	cellular component
GO:0007050	cell cycle arrest	IDA	biological process
GO:0009749	response to glucose	IDA	biological process
GO:0010595	positive regulation of endothelial cell migration	IDA	biological process
GO:0010596	negative regulation of endothelial cell migration	IDA	biological process
GO:0010754	negative regulation of cGMP-mediated signaling	IDA	biological process
GO:0010757	negative regulation of plasminogen activation	IDA	biological process
GO:0016477	cell migration	IDA	biological process
GO:0016525	negative regulation of angiogenesis	IDA	biological process
GO:0016525	negative regulation of angiogenesis	IDA	biological process
GO:0030141	secretory granule	IDA	cellular component
GO:0030335	positive regulation of cell migration	IDA	biological process
GO:0032695	negative regulation of interleukin-12 production	IDA	biological process
GO:0043536	positive regulation of blood vessel endothelial cell migration	IDA	biological process
GO:0043652	engulfment of apoptotic cell	IDA	biological process
GO:0045727	positive regulation of translation	IDA	biological process
GO:0050921	positive regulation of chemotaxis	IDA	biological process
GO:0051592	response to calcium ion	IDA	biological process
GO:0051592	response to calcium ion	IDA	biological process
GO:0051918	negative regulation of fibrinolysis	IDA	biological process
GO:1902043	positive regulation of extrinsic apoptotic signaling pathway via death domain receptors	IDA	biological process
GO:0000187	activation of MAPK activity	IMP	biological process
GO:0001666	response to hypoxia	NAS	biological process
GO:0001937	negative regulation of endothelial cell proliferation	IMP	biological process
GO:0002040	sprouting angiogenesis	IMP	biological process
GO:0002544	chronic inflammatory response	IEP	biological process
GO:0005615	extracellular space	HDA	cellular component
GO:0010759	positive regulation of macrophage chemotaxis	ISS	biological process
GO:0030335	positive regulation of cell migration	IMP	biological process
GO:0062023	collagen-containing extracellular matrix	ISS	colocalizes with
GO:0062023	collagen-containing extracellular matrix	TAS	cellular component
GO:0062023	collagen-containing extracellular matrix	HDA	colocalizes with
GO:0032570	response to progesterone	TAS	biological process
GO:0032914	positive regulation of transforming growth factor beta1 production	ISS	biological process
GO:0034605	cellular response to heat	NAS	biological process
GO:0051895	negative regulation of focal adhesion assembly	TAS	biological process
GO:0005615	extracellular space	IDA	cellular component
GO:0009897	external side of plasma membrane	IDA	cellular component
GO:0009986	cell surface	IDA	cellular component
GO:0009986	cell surface	IDA	cellular component
GO:0009986	cell surface	IDA	cellular component
GO:0010748	negative regulation of long-chain fatty acid import across plasma membrane	IDA	biological process
GO:0010751	negative regulation of nitric oxide mediated signal transduction	IDA	biological process
GO:0010763	positive regulation of fibroblast migration	IDA	biological process
GO:0018149	peptide cross-linking	IDA	biological process
GO:0030194	positive regulation of blood coagulation	IDA	biological process
GO:0030511	positive regulation of transforming growth factor beta receptor signaling pathway	IDA	biological process
GO:0031091	platelet alpha granule	IDA	cellular component
GO:0032026	response to magnesium ion	IDA	biological process
GO:0040037	negative regulation of fibroblast growth factor receptor signaling pathway	IDA	biological process
GO:0043032	positive regulation of macrophage activation	IDA	biological process
GO:0043537	negative regulation of blood vessel endothelial cell migration	IDA	biological process
GO:2000379	positive regulation of reactive oxygen species metabolic process	IDA	biological process
GO:0008284	positive regulation of cell population proliferation	IDA	biological process
GO:0016525	negative regulation of angiogenesis	IMP	biological process
GO:1903671	negative regulation of sprouting angiogenesis	IGI	biological process
GO:0062023	collagen-containing extracellular matrix	HDA	cellular component
GO:0006955	immune response	IEP	biological process
GO:0007155	cell adhesion	NAS	biological process
GO:0042327	positive regulation of phosphorylation	IMP	biological process
GO:0045766	positive regulation of angiogenesis	IMP	biological process
GO:0045766	positive regulation of angiogenesis	IMP	biological process
GO:2001237	negative regulation of extrinsic apoptotic signaling pathway	TAS	biological process
GO:0062023	collagen-containing extracellular matrix	HDA	cellular component
GO:0062023	collagen-containing extracellular matrix	HDA	cellular component
GO:0005576	extracellular region	HDA	cellular component
GO:1903588	negative regulation of blood vessel endothelial cell proliferation involved in sprouting angiogenesis	IMP	biological process
GO:0090051	negative regulation of cell migration involved in sprouting angiogenesis	IMP	biological process
GO:0048661	positive regulation of smooth muscle cell proliferation	IDA	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0016529	sarcoplasmic reticulum	IEA	cellular component
GO:0009986	cell surface	IEA	cellular component
GO:0031012	extracellular matrix	IDA	cellular component
GO:0016525	negative regulation of angiogenesis	IDA	biological process
GO:0043066	negative regulation of apoptotic process	IDA	biological process
GO:0001786	phosphatidylserine binding	IDA	molecular function
GO:2000353	positive regulation of endothelial cell apoptotic process	IDA	biological process
GO:0042535	positive regulation of tumor necrosis factor biosynthetic process	IDA	biological process
GO:0051897	positive regulation of protein kinase B signaling	IDA	biological process
GO:0043154	negative regulation of cysteine-type endopeptidase activity involved in apoptotic process	IDA	biological process
GO:0070062	extracellular exosome	HDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0042493	response to drug	IEP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0070062	extracellular exosome	HDA	cellular component
GO:0005615	extracellular space	HDA	cellular component
GO:0062023	collagen-containing extracellular matrix	HDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04151	PI3K-Akt signaling pathway
hsa05165	Human papillomavirus infection
hsa05206	MicroRNAs in cancer
hsa04015	Rap1 signaling pathway
hsa04510	Focal adhesion
hsa05205	Proteoglycans in cancer
hsa04145	Phagosome
hsa04512	ECM-receptor interaction
hsa04350	TGF-beta signaling pathway
hsa04115	p53 signaling pathway
hsa05144	Malaria
hsa05219	Bladder cancer

Diseases

Associated diseases	References
urinary bladder cancer	PMID:20299037
pancreatic cancer	PMID:20203415
pancreatic cancer	PMID:10766168
pancreatic ductal carcinoma	PMID:12429967
pancreatic ductal carcinoma	PMID:19065635
cholangiocarcinoma	PMID:16465407
cholangiocarcinoma	PMID:11927969
cholangiocarcinoma	PMID:12213730
obesity	PMID:24086512
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq