Male Infertility Database

Search Result

Gene id

7039

Gene Summary Protein Summary Gene ontology KEGG pathways Diseases PubMed

Gene Summary

Gene Symbol

TGFA Gene UCSC Ensembl

Aliases

TFGA

Gene name

transforming growth factor alpha

Alternate names

protransforming growth factor alpha, TGF-alpha,

Gene location

2p13.3 (95943330: 95968719) Exons: 9 NC_000012.12

Gene summary(Entrez)

This gene encodes a growth factor that is a ligand for the epidermal growth factor receptor, which activates a signaling pathway for cell proliferation, differentiation and development. This protein may act as either a transmembrane-bound ligand or a solu

OMIM

190170

Protein Summary

Protein general information

P01135

Name: Protransforming growth factor alpha [Cleaved into: Transforming growth factor alpha (TGF alpha) (EGF like TGF) (ETGF) (TGF type 1)]

Length: 160 Mass: 17006

Tissue specificity: Isoform 1, isoform 3 and isoform 4 are expressed in keratinocytes and tumor-derived cell lines. {ECO

Sequence

MVPSAGQLALFALGIVLAACQALENSTSPLSADPPVAAAVVSHFNDCPDSHTQFCFHGTCRFLVQEDKPACVCHS
GYVGARCEHADLLAVVAASQKKQAITALVVVSIVALAVLIITCVLIHCCQVRKHCEWCRALICRHEKPSALLKGR
TACCHSETVV

Structural information

Protein Domains	(43..8-) (/note="EGF-like-) (/evidence="ECO:0000255\|PROSITE-ProRule:PRU00076"-)
Interpro:	IPR013032 IPR000742
Prosite:	PS00022 PS01186 PS50026
PDB:	1GK5 1MOX 1YUF 1YUG 2TGF 3E50 3TGF 4TGF 5KN5
PDBsum:	1GK5 1MOX 1YUF 1YUG 2TGF 3E50 3TGF 4TGF 5KN5
DIP:	5765
MINT:
STRING:	ENSP00000295400

Other Databases

GeneCards: TGFA Malacards: TGFA

Gene ontology

Expand All | Collapse All

GO accession	Term name	Evidence code	Go category
GO:0008083	growth factor activity	IDA	molecular function
GO:0000187	activation of MAPK activi ty	IDA	biological process
GO:0050679	positive regulation of ep ithelial cell proliferati on	IDA	biological process
GO:0045741	positive regulation of ep idermal growth factor-act ivated receptor activity	IDA	biological process
GO:0045840	positive regulation of mi totic nuclear division	IDA	biological process
GO:0008284	positive regulation of ce ll population proliferati on	IBA	biological process
GO:0005615	extracellular space	IBA	cellular component
GO:0005154	epidermal growth factor r eceptor binding	IBA	molecular function
GO:0000187	activation of MAPK activi ty	IBA	biological process
GO:0045840	positive regulation of mi totic nuclear division	IBA	biological process
GO:0045741	positive regulation of ep idermal growth factor-act ivated receptor activity	IBA	biological process
GO:0008083	growth factor activity	IBA	molecular function
GO:0007173	epidermal growth factor r eceptor signaling pathway	IBA	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0051781	positive regulation of ce ll division	IEA	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of mem brane	IEA	cellular component
GO:0008083	growth factor activity	IEA	molecular function
GO:0005886	plasma membrane	NAS	cellular component
GO:0000165	MAPK cascade	TAS	biological process
GO:0006888	endoplasmic reticulum to Golgi vesicle-mediated tr ansport	TAS	biological process
GO:0007173	epidermal growth factor r eceptor signaling pathway	TAS	biological process
GO:0033116	endoplasmic reticulum-Gol gi intermediate compartme nt membrane	TAS	cellular component
GO:0042059	negative regulation of ep idermal growth factor rec eptor signaling pathway	TAS	biological process
GO:0051897	positive regulation of pr otein kinase B signaling	TAS	biological process
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005789	endoplasmic reticulum mem brane	TAS	cellular component
GO:0005789	endoplasmic reticulum mem brane	TAS	cellular component
GO:0005789	endoplasmic reticulum mem brane	TAS	cellular component
GO:0005789	endoplasmic reticulum mem brane	TAS	cellular component
GO:0005789	endoplasmic reticulum mem brane	TAS	cellular component
GO:0005789	endoplasmic reticulum mem brane	TAS	cellular component
GO:0005789	endoplasmic reticulum mem brane	TAS	cellular component
GO:0005789	endoplasmic reticulum mem brane	TAS	cellular component
GO:0006357	regulation of transcripti on by RNA polymerase II	TAS	biological process
GO:0007165	signal transduction	TAS	biological process
GO:0012507	ER to Golgi transport ves icle membrane	TAS	cellular component
GO:0012507	ER to Golgi transport ves icle membrane	TAS	cellular component
GO:0012507	ER to Golgi transport ves icle membrane	TAS	cellular component
GO:0012507	ER to Golgi transport ves icle membrane	TAS	cellular component
GO:0012507	ER to Golgi transport ves icle membrane	TAS	cellular component
GO:0012507	ER to Golgi transport ves icle membrane	TAS	cellular component
GO:0030665	clathrin-coated vesicle m embrane	TAS	cellular component
GO:0030665	clathrin-coated vesicle m embrane	TAS	cellular component
GO:0030665	clathrin-coated vesicle m embrane	TAS	cellular component
GO:0030665	clathrin-coated vesicle m embrane	TAS	cellular component
GO:0030665	clathrin-coated vesicle m embrane	TAS	cellular component
GO:0030665	clathrin-coated vesicle m embrane	TAS	cellular component
GO:0030665	clathrin-coated vesicle m embrane	TAS	cellular component
GO:0048208	COPII vesicle coating	TAS	biological process
GO:0061024	membrane organization	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005615	extracellular space	IDA	cellular component
GO:0016323	basolateral plasma membra ne	IDA	cellular component
GO:0031410	cytoplasmic vesicle	IDA	cellular component
GO:0048471	perinuclear region of cyt oplasm	IDA	cellular component
GO:0009986	cell surface	IDA	cellular component
GO:0005615	extracellular space	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0035556	intracellular signal tran sduction	TAS	biological process
GO:0000139	Golgi membrane	IEA	cellular component
GO:0005154	epidermal growth factor r eceptor binding	IDA	molecular function

KEGG pathways

Expand All | Collapse All

Pathway id	Pathway name
hsa05200	Pathways in cancer
hsa04151	PI3K-Akt signaling pathway
hsa04010	MAPK signaling pathway
hsa04014	Ras signaling pathway
hsa05225	Hepatocellular carcinoma
hsa04915	Estrogen signaling pathway
hsa04012	ErbB signaling pathway
hsa05210	Colorectal cancer
hsa05215	Prostate cancer
hsa05214	Glioma
hsa05212	Pancreatic cancer
hsa01521	EGFR tyrosine kinase inhibitor resistance
hsa05211	Renal cell carcinoma
hsa05223	Non-small cell lung cancer
hsa05200	Pathways in cancer
hsa04151	PI3K-Akt signaling pathway
hsa04915	Estrogen signaling pathway
hsa04010	MAPK signaling pathway
hsa04014	Ras signaling pathway
hsa05225	Hepatocellular carcinoma
hsa05223	Non-small cell lung cancer
hsa05214	Glioma
hsa05215	Prostate cancer
hsa01521	EGFR tyrosine kinase inhibitor resistance
hsa05212	Pancreatic cancer
hsa05210	Colorectal cancer
hsa04012	ErbB signaling pathway
hsa05211	Renal cell carcinoma

Diseases

Expand All | Collapse All

Associated diseases	References
Cancer (oral)	GAD: 15864136
Cutaneous malignant melanoma	GAD: 2902017
Cancer (gastric)	GAD: 20047592
Esophageal adenocarcinoma	GAD: 20453000
Colorectal cancer	KEGG: H00020
Cancer (hepatocellular)	KEGG: H00048
Cleft defects	GAD: 16311697
Preeclampsia	GAD: 19708171
Polycystic ovary syndrome (PCOS)	INFBASE: 7608254
Sertoli cell only syndrome (SCOS)	MIK: 8804155
Sertoli cell only syndrome (SCOS)	MIK: 8804155
Decreased spermatogenesis	MIK: 8804155
Decreased spermatogenesis	MIK: 8804155
Oral clefts	GAD: 15643916
Colorectal cancer	KEGG:H00020
Hepatocellular carcinoma	KEGG:H00048
Colorectal cancer	KEGG:H00020
Hepatocellular carcinoma	KEGG:H00048
pancreatic cancer	PMID:1401070
Insulinoma	PMID:8712689
gallbladder carcinoma	PMID:9542514
Teratozoospermia	MIK: 17327269

PubMed references

Expand All | Collapse All

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes	Abstract
17327269	Teratozoos permia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)	Show abstract

Male Infertility knowledgebase

A repository with genes crucial for male fertility

Search Result

Gene Summary

Protein Summary

Gene ontology

Expand All | Collapse All

KEGG pathways

Expand All | Collapse All

Expand All | Collapse All

Diseases

Expand All | Collapse All

Expand All | Collapse All

PubMed references

Expand All | Collapse All

Male Infertility knowledgebase

A repository with genes crucial for male fertility

Search Result

Gene Summary

Protein Summary

Gene ontology

Expand All | Collapse All

KEGG pathways Expand All | Collapse All

Expand All | Collapse All

Diseases Expand All | Collapse All

Expand All | Collapse All

PubMed references

Expand All | Collapse All

KEGG pathways

Expand All | Collapse All

Diseases

Expand All | Collapse All