• Gene id: 7035

Gene Summary

• Gene Symbol: TFPI   Gene   UCSC   Ensembl
• Aliases: EPI, LACI, TFI, TFPI1
• Gene name: tissue factor pathway inhibitor
• Alternate names: tissue factor pathway inhibitor, anti-convertin, extrinsic pathway inhibitor, tissue factor pathway inhibitor (lipoprotein-associated coagulation inhibitor),
• Gene location: 2q32.1 (187554504: 187464229)     Exons: 13     NC_000002.12
• Gene summary(Entrez): This gene encodes a Kunitz-type serine protease inhibitor that regulates the tissue factor (TF)-dependent pathway of blood coagulation. The coagulation process initiates with the formation of a factor VIIa-TF complex, which proteolytically activates addit
• OMIM: 152310

Protein Summary

• Protein general information: P10646  
  • Name: Tissue factor pathway inhibitor (TFPI) (Extrinsic pathway inhibitor) (EPI) (Lipoprotein associated coagulation inhibitor) (LACI)
  • Length: 304  
  • Mass: 35015
  • Tissue specificity: Mostly in endothelial cells.
• Sequence:

  MIYTMKKVHALWASVCLLLNLAPAPLNADSEEDEEHTIITDTELPPLKLMHSFCAFKADDGPCKAIMKRFFFNIF
  TRQCEEFIYGGCEGNQNRFESLEECKKMCTRDNANRIIKTTLQQEKPDFCFLEEDPGICRGYITRYFYNNQTKQC
  ERFKYGGCLGNMNNFETLEECKNICEDGPNGFQVDNYGTQLNAVNNSLTPQSTKVPSLFEFHGPSWCLTPADRGL
  CRANENRFYYNSVIGKCRPFKYSGCGGNENNFTSKQECLRACKKGFIQRISKGGLIKTKRKRKKQRVKIAYEEIF
  VKNM

• Structural information:
  • Protein Domains: (54..10-)
    1 (/note="BPTI/Kunitz-inhibitor)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00031-)
    (125..17-)
    2 (/note="BPTI/Kunitz-inhibitor)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00031-)
    (217..26-)
    3 (/note="BPTI/Kunitz-inhibitor)
    (-)
  • Interpro: IPR002223  IPR036880  IPR020901  IPR008296  
  • Prosite: PS00280 PS50279
  • CDD: cd00109
  • PDB: 1ADZ 1IRH 1TFX 4BQD 4DTG 5NMV 6BX8
  • PDBsum: 1ADZ 1IRH 1TFX 4BQD 4DTG 5NMV 6BX8
  • STRING: ENSP00000233156
• Other Databases: GeneCards:  TFPI  Malacards:  TFPI

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005615	extracellular space	IBA	cellular component
GO:0004867	serine-type endopeptidase inhibitor activity	IBA	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0010466	negative regulation of peptidase activity	IEA	biological process
GO:0030414	peptidase inhibitor activity	IEA	molecular function
GO:0004867	serine-type endopeptidase inhibitor activity	IEA	molecular function
GO:0030414	peptidase inhibitor activity	IEA	molecular function
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0007599	hemostasis	IEA	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0007596	blood coagulation	IEA	biological process
GO:0010466	negative regulation of peptidase activity	IEA	biological process
GO:0043231	intracellular membrane-bounded organelle	IEA	cellular component
GO:0004867	serine-type endopeptidase inhibitor activity	IEA	molecular function
GO:0031225	anchored component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0004866	endopeptidase inhibitor activity	TAS	molecular function
GO:0007596	blood coagulation	TAS	biological process
GO:0005886	plasma membrane	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0007598	blood coagulation, extrinsic pathway	TAS	biological process
GO:0005615	extracellular space	IEA	cellular component
GO:0032355	response to estradiol	IEA	biological process
GO:0071222	cellular response to lipopolysaccharide	IEA	biological process
GO:0032496	response to lipopolysaccharide	IEA	biological process
GO:0071347	cellular response to interleukin-1	IEA	biological process
GO:0005615	extracellular space	IDA	cellular component
GO:0005576	extracellular region	IEA	cellular component
GO:0031090	organelle membrane	IEA	cellular component
GO:0010951	negative regulation of endopeptidase activity	IEA	biological process
GO:0010951	negative regulation of endopeptidase activity	IEA	biological process
GO:0010951	negative regulation of endopeptidase activity	IEA	biological process
GO:0010951	negative regulation of endopeptidase activity	IEA	biological process
GO:0005901	caveola	IDA	cellular component
GO:0030195	negative regulation of blood coagulation	IDA	biological process
GO:0009986	cell surface	IDA	cellular component
GO:0009986	cell surface	HDA	cellular component
GO:0071383	cellular response to steroid hormone stimulus	IEP	biological process

KEGG pathways

Pathway id	Pathway name
hsa04610	Complement and coagulation cascades

Diseases

Associated diseases	References
Idiopathic pulmonary fibrosis	PMID:10946084
Preterm premature rupture of the membranes	PMID:19012190
Osteonecrosis	PMID:18695356
Pre-eclampsia	PMID:10078579
Thrombotic thrombocytopenic purpura	PMID:7740478
Intravascular coagulation	PMID:8914465
Intravascular coagulation	PMID:11074537
Intravascular coagulation	PMID:8292719
Intravascular coagulation	PMID:8929465
Familial hyperlipidemia	PMID:8914465
Nephrotic syndrome	PMID:22319062
factor VIII deficiency	PMID:24687919
factor VIII deficiency	PMID:24263002
leukemia	PMID:18549615
leukemia	PMID:12206017
Factor V deficiency	PMID:18695002
Transient cerebral ischemia	PMID:18067952
Protein S deficiency	PMID:20002538
Pulmonary fibrosis	PMID:16338226
ovarian hyperstimulation syndrome	PMID:12695751
Myocardial infarction	PMID:14656922
Myocardial infarction	PMID:15630488
Systemic lupus erythematosus	PMID:11709459
diabetes mellitus	PMID:8914465
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
31037746	Spermatogenic defects			28 men with azoospermia	Male infertility	Microarray