• Gene id: 7032

Gene Summary

• Gene Symbol: TFF2   Gene   UCSC   Ensembl
• Aliases: SML1, SP
• Gene name: trefoil factor 2
• Alternate names: trefoil factor 2, spasmolysin, spasmolytic polypeptide, spasmolytic protein 1,
• Gene location: 21q22.3 (42350993: 42346356)     Exons: 4     NC_000021.9
• Gene summary(Entrez): Members of the trefoil family are characterized by having at least one copy of the trefoil motif, a 40-amino acid domain that contains three conserved disulfides. They are stable secretory proteins expressed in gastrointestinal mucosa. Their functions are
• OMIM: 182590

Protein Summary

• Protein general information: Q03403  
  • Name: Trefoil factor 2 (Spasmolysin) (Spasmolytic polypeptide) (SP)
  • Length: 129  
  • Mass: 14284
  • Tissue specificity: Stomach.
• Sequence:

  MGRRDAQLLAALLVLGLCALAGSEKPSPCQCSRLSPHNRTNCGFPGITSDQCFDNGCCFDSSVTGVPWCFHPLPK
  QESDQCVMEVSDRRNCGYPGISPEECASRKCCFSNFIFEVPWCFFPKSVEDCHY

• Structural information:
  • Protein Domains: (29..7-)
    (/note="P-type-1)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00779-)
    (79..12-)
    (/note="P-type-2)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00779"-)
  • Interpro: IPR017994  IPR017957  IPR000519  
  • Prosite: PS00025 PS51448
  • CDD: cd00111
  • STRING: ENSP00000291526
• Other Databases: GeneCards:  TFF2  Malacards:  TFF2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005615	extracellular space	IBA	cellular component
GO:0031723	CXCR4 chemokine receptor binding	IBA	molecular function
GO:0060455	negative regulation of gastric acid secretion	IBA	biological process
GO:0070098	chemokine-mediated signaling pathway	IBA	biological process
GO:0030277	maintenance of gastrointestinal epithelium	IBA	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005576	extracellular region	IEA	cellular component

KEGG pathways

Pathway id	Pathway name
P06959	CCKR signaling map
P06959	CCKR signaling map

Diseases

Associated diseases	References
Prostate cancer	PMID:16467092
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)