• Gene id: 7026

Gene Summary

• Gene Symbol: NR2F2   Gene   UCSC   Ensembl
• Aliases: ARP1, CHTD4, COUPTF2, COUPTFB, COUPTFII, NF-E3, NR2F1, SVP40, TFCOUP2
• Gene name: nuclear receptor subfamily 2 group F member 2
• Alternate names: COUP transcription factor 2, ADP-ribosylation factor related protein 1, COUP transcription factor II, apolipoprotein A-I regulatory protein 1, apolipoprotein AI regulatory protein 1, chicken ovalbumin upstream promoter transcription factor 2, chicken oval,
• Gene location: 15q26.2 (96325927: 96340262)     Exons: 6     NC_000015.10
• Gene summary(Entrez): This gene encodes a member of the steroid thyroid hormone superfamily of nuclear receptors. The encoded protein is a ligand inducible transcription factor that is involved in the regulation of many different genes. Alternate splicing results in multiple t
• OMIM: 107773

Protein Summary

• Protein general information: P24468  
  • Name: COUP transcription factor 2 (COUP TF2) (Apolipoprotein A I regulatory protein 1) (ARP 1) (COUP transcription factor II) (COUP TF II) (Nuclear receptor subfamily 2 group F member 2)
  • Length: 414  
  • Mass: 45,571
• Sequence:

  MAMVVSTWRDPQDEVPGSQGSQASQAPPVPGPPPGAPHTPQTPGQGGPASTPAQTAAGGQGGPGGPGSDKQQQQQ
  HIECVVCGDKSSGKHYGQFTCEGCKSFFKRSVRRNLSYTCRANRNCPIDQHHRNQCQYCRLKKCLKVGMRREAVQ
  RGRMPPTQPTHGQFALTNGDPLNCHSYLSGYISLLLRAEPYPTSRFGSQCMQPNNIMGIENICELAARMLFSAVE
  WARNIPFFPDLQITDQVALLRLTWSELFVLNAAQCSMPLHVAPLLAAAGLHASPMSADRVVAFMDHIRIFQEQVE
  KLKALHVDSAEYSCLKAIVLFTSDACGLSDVAHVESLQEKSQCALEEYVRSQYPNQPTRFGKLLLRLPSLRTVSS
  SVIEQLFFVRLVGKTPIETLIRDMLLSGSSFNWPYMAIQ

• Structural information:
  • Protein Domains: NR (177-403)
  • Interpro: IPR003068  IPR035500  IPR000536  IPR001723  IPR001628   IPR013088  
  • Prosite: PS51843 PS00031 PS51030
  • PDB: 3CJW
  • PDBsum: 3CJW
  • DIP: 29713
  • STRING: ENSP00000377721
• Other Databases: GeneCards:  NR2F2  Malacards:  NR2F2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000122	negative regulation of transcription from RNA polymerase II promoter	IDA	biological process
GO:0001764	neuron migration	IEA	biological process
GO:0001893	maternal placenta development	IEA	biological process
GO:0001937	negative regulation of endothelial cell proliferation	IMP	biological process
GO:0001972	retinoic acid binding	IDA	molecular function
GO:0003700	transcription factor activity, sequence-specific DNA binding	IDA	molecular function
GO:0003707	steroid hormone receptor activity	IEA	molecular function
GO:0003714	transcription corepressor activity	TAS	molecular function
GO:0004879	RNA polymerase II transcription factor activity, ligand-activated sequence-specific DNA binding	IDA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IDA	cellular component
GO:0006351	transcription, DNA-templated	IEA	biological process
GO:0006357	regulation of transcription from RNA polymerase II promoter	TAS	biological process
GO:0006629	lipid metabolic process	TAS	biological process
GO:0007165	signal transduction	TAS	biological process
GO:0007519	skeletal muscle tissue development	IEA	biological process
GO:0008270	zinc ion binding	IEA	molecular function
GO:0009566	fertilization	IEA	biological process
GO:0009952	anterior/posterior pattern specification	IEA	biological process
GO:0009956	radial pattern formation	IEA	biological process
GO:0010596	negative regulation of endothelial cell migration	IMP	biological process
GO:0030522	intracellular receptor signaling pathway	IEA	biological process
GO:0030900	forebrain development	IEA	biological process
GO:0032355	response to estradiol	IEA	biological process
GO:0042803	protein homodimerization activity	IPI	molecular function
GO:0043401	steroid hormone mediated signaling pathway	IEA	biological process
GO:0043565	sequence-specific DNA binding	IDA	molecular function
GO:0045736	negative regulation of cyclin-dependent protein serine/threonine kinase activity	IDA	biological process
GO:0045892	negative regulation of transcription, DNA-templated	IDA	biological process
GO:0045893	positive regulation of transcription, DNA-templated	IDA	biological process
GO:0045893	positive regulation of transcription, DNA-templated	IMP	biological process
GO:0048514	blood vessel morphogenesis	IEA	biological process
GO:0060173	limb development	IEA	biological process
GO:0060674	placenta blood vessel development	IEA	biological process
GO:0060707	trophoblast giant cell differentiation	IEA	biological process
GO:0060849	regulation of transcription involved in lymphatic endothelial cell fate commitment	IMP	biological process
GO:0000122	negative regulation of transcription from RNA polymerase II promoter	IEA	biological process
GO:0000122	negative regulation of transcription from RNA polymerase II promoter	IDA	biological process
GO:0001701	in utero embryonic development	IEA	biological process
GO:0001764	neuron migration	IEA	biological process
GO:0001893	maternal placenta development	IEA	biological process
GO:0001937	negative regulation of endothelial cell proliferation	IMP	biological process
GO:0001945	lymph vessel development	IEA	biological process
GO:0001972	retinoic acid binding	IDA	molecular function
GO:0003677	DNA binding	IEA	molecular function
GO:0003677	DNA binding	IEA	molecular function
GO:0003677	DNA binding	IEA	molecular function
GO:0003700	transcription factor activity, sequence-specific DNA binding	IEA	molecular function
GO:0003700	transcription factor activity, sequence-specific DNA binding	IDA	molecular function
GO:0003707	steroid hormone receptor activity	IEA	molecular function
GO:0003714	transcription corepressor activity	TAS	molecular function
GO:0004879	RNA polymerase II transcription factor activity, ligand-activated sequence-specific DNA binding	IEA	molecular function
GO:0004879	RNA polymerase II transcription factor activity, ligand-activated sequence-specific DNA binding	IDA	molecular function
GO:0004879	RNA polymerase II transcription factor activity, ligand-activated sequence-specific DNA binding	TAS	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0006351	transcription, DNA-templated	IEA	biological process
GO:0006355	regulation of transcription, DNA-templated	IEA	biological process
GO:0006355	regulation of transcription, DNA-templated	IEA	biological process
GO:0006355	regulation of transcription, DNA-templated	IEA	biological process
GO:0006357	regulation of transcription from RNA polymerase II promoter	IEA	biological process
GO:0006357	regulation of transcription from RNA polymerase II promoter	TAS	biological process
GO:0006629	lipid metabolic process	TAS	biological process
GO:0007165	signal transduction	TAS	biological process
GO:0007519	skeletal muscle tissue development	IEA	biological process
GO:0008270	zinc ion binding	IEA	molecular function
GO:0009566	fertilization	IEA	biological process
GO:0009952	anterior/posterior pattern specification	IEA	biological process
GO:0009956	radial pattern formation	IEA	biological process
GO:0010596	negative regulation of endothelial cell migration	IMP	biological process
GO:0030522	intracellular receptor signaling pathway	IEA	biological process
GO:0030900	forebrain development	IEA	biological process
GO:0032355	response to estradiol	IEA	biological process
GO:0042803	protein homodimerization activity	IPI	molecular function
GO:0043401	steroid hormone mediated signaling pathway	IEA	biological process
GO:0043565	sequence-specific DNA binding	IEA	molecular function
GO:0043565	sequence-specific DNA binding	IEA	molecular function
GO:0043565	sequence-specific DNA binding	IDA	molecular function
GO:0045736	negative regulation of cyclin-dependent protein serine/threonine kinase activity	IDA	biological process
GO:0045892	negative regulation of transcription, DNA-templated	IDA	biological process
GO:0045893	positive regulation of transcription, DNA-templated	IDA	biological process
GO:0045893	positive regulation of transcription, DNA-templated	IMP	biological process
GO:0046872	metal ion binding	IEA	molecular function
GO:0048514	blood vessel morphogenesis	IEA	biological process
GO:0060173	limb development	IEA	biological process
GO:0060674	placenta blood vessel development	IEA	biological process
GO:0060707	trophoblast giant cell differentiation	IEA	biological process
GO:0060849	regulation of transcription involved in lymphatic endothelial cell fate commitment	IMP	biological process
GO:0000122	negative regulation of transcription from RNA polymerase II promoter	IDA	biological process
GO:0001937	negative regulation of endothelial cell proliferation	IMP	biological process
GO:0001972	retinoic acid binding	IDA	molecular function
GO:0003700	transcription factor activity, sequence-specific DNA binding	IDA	molecular function
GO:0003714	transcription corepressor activity	TAS	molecular function
GO:0004879	RNA polymerase II transcription factor activity, ligand-activated sequence-specific DNA binding	IDA	molecular function
GO:0004879	RNA polymerase II transcription factor activity, ligand-activated sequence-specific DNA binding	TAS	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IDA	cellular component
GO:0006357	regulation of transcription from RNA polymerase II promoter	TAS	biological process
GO:0006629	lipid metabolic process	TAS	biological process
GO:0007165	signal transduction	TAS	biological process
GO:0010596	negative regulation of endothelial cell migration	IMP	biological process
GO:0042803	protein homodimerization activity	IPI	molecular function
GO:0043565	sequence-specific DNA binding	IDA	molecular function
GO:0045736	negative regulation of cyclin-dependent protein serine/threonine kinase activity	IDA	biological process
GO:0045892	negative regulation of transcription, DNA-templated	IDA	biological process
GO:0045893	positive regulation of transcription, DNA-templated	IDA	biological process
GO:0045893	positive regulation of transcription, DNA-templated	IMP	biological process
GO:0060849	regulation of transcription involved in lymphatic endothelial cell fate commitment	IMP	biological process

Diseases

Associated diseases	References
Arthritis	GAD: 20549515
Ovarian endometriosis	INFBASE: 16815388
Unexplained azoospermia	MIK: 26662397
Spermatogenesis defects	MIK: 26662397
Endometriosis	INFBASE: 15299092
Female infertility	INFBASE: 19001523
Spermatogenic defects	MIK: 26662397
Unexplained azoospermia	MIK: 26662397
Teratozoospermia	MIK: 17327269
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
26662397	Spermatogenic failure, unexplained azoospermia	16 CNVs in 13 patients with chormosomal abnormalities, 26 CNVs in 20 unexplained azoospermic patients		36(13 spermatogenic failure patients with chromosomal abnormalities, 20 unexplained azoospermia)	Male infertility	EDDM3A EDDM3B HLA-DRB1 HLA-DQA1 POTE B GOLGA8C DNMT3L ALF NPHP1 NRG1 RID2 ADAMTS20 TWF1 COX10 MAK and DNEL1
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray