About Us

Search Result


Gene id 7010
Gene Summary    Protein Summary    Gene ontology    KEGG pathways    Diseases    PubMed    

Gene Summary

Gene Symbol TEK   Gene   UCSC   Ensembl
Aliases CD202B, GLC3E, TIE-2, TIE2, VMCM, VMCM1
Gene name TEK receptor tyrosine kinase
Alternate names angiopoietin-1 receptor, TEK tyrosine kinase, endothelial, endothelial tyrosine kinase, tunica interna endothelial cell kinase, tyrosine kinase with Ig and EGF homology domains-2, tyrosine-protein kinase receptor TEK, tyrosine-protein kinase receptor TIE-2,
Gene location 9p21.2 (27109140: 27230177)     Exons: 23     NC_000009.12
Gene summary(Entrez) This gene encodes a receptor that belongs to the protein tyrosine kinase Tie2 family. The encoded protein possesses a unique extracellular region that contains two immunoglobulin-like domains, three epidermal growth factor (EGF)-like domains and three fib
OMIM 600221

Protein Summary

Protein general information Q02763  

Name: Angiopoietin 1 receptor (EC 2.7.10.1) (Endothelial tyrosine kinase) (Tunica interna endothelial cell kinase) (Tyrosine kinase with Ig and EGF homology domains 2) (Tyrosine protein kinase receptor TEK) (Tyrosine protein kinase receptor TIE 2) (hTIE2) (p140

Length: 1124  Mass: 125830

Tissue specificity: Detected in umbilical vein endothelial cells. Proteolytic processing gives rise to a soluble extracellular domain that is detected in blood plasma (at protein level). Predominantly expressed in endothelial cells and their progenitors,

Sequence MDSLASLVLCGVSLLLSGTVEGAMDLILINSLPLVSDAETSLTCIASGWRPHEPITIGRDFEALMNQHQDPLEVT
QDVTREWAKKVVWKREKASKINGAYFCEGRVRGEAIRIRTMKMRQQASFLPATLTMTVDKGDNVNISFKKVLIKE
EDAVIYKNGSFIHSVPRHEVPDILEVHLPHAQPQDAGVYSARYIGGNLFTSAFTRLIVRRCEAQKWGPECNHLCT
ACMNNGVCHEDTGECICPPGFMGRTCEKACELHTFGRTCKERCSGQEGCKSYVFCLPDPYGCSCATGWKGLQCNE
ACHPGFYGPDCKLRCSCNNGEMCDRFQGCLCSPGWQGLQCEREGIQRMTPKIVDLPDHIEVNSGKFNPICKASGW
PLPTNEEMTLVKPDGTVLHPKDFNHTDHFSVAIFTIHRILPPDSGVWVCSVNTVAGMVEKPFNISVKVLPKPLNA
PNVIDTGHNFAVINISSEPYFGDGPIKSKKLLYKPVNHYEAWQHIQVTNEIVTLNYLEPRTEYELCVQLVRRGEG
GEGHPGPVRRFTTASIGLPPPRGLNLLPKSQTTLNLTWQPIFPSSEDDFYVEVERRSVQKSDQQNIKVPGNLTSV
LLNNLHPREQYVVRARVNTKAQGEWSEDLTAWTLSDILPPQPENIKISNITHSSAVISWTILDGYSISSITIRYK
VQGKNEDQHVDVKIKNATITQYQLKGLEPETAYQVDIFAENNIGSSNPAFSHELVTLPESQAPADLGGGKMLLIA
ILGSAGMTCLTVLLAFLIILQLKRANVQRRMAQAFQNVREEPAVQFNSGTLALNRKVKNNPDPTIYPVLDWNDIK
FQDVIGEGNFGQVLKARIKKDGLRMDAAIKRMKEYASKDDHRDFAGELEVLCKLGHHPNIINLLGACEHRGYLYL
AIEYAPHGNLLDFLRKSRVLETDPAFAIANSTASTLSSQQLLHFAADVARGMDYLSQKQFIHRDLAARNILVGEN
YVAKIADFGLSRGQEVYVKKTMGRLPVRWMAIESLNYSVYTTNSDVWSYGVLLWEIVSLGGTPYCGMTCAELYEK
LPQGYRLEKPLNCDDEVYDLMRQCWREKPYERPSFAQILVSLNRMLEERKTYVNTTLYEKFTYAGIDCSAEEAA
Structural information
Protein Domains
(44..12-)
1 (/note="Ig-like-C2-type)
(210..25-)
(/note="EGF-like-1)
(/evidence="ECO:0000255|PROSITE-ProRule:PRU00076-)
(254..29-)
(/note="EGF-like-2)
(/evidence="ECO:0000255|PROSITE-ProRule:PRU00076-)
(301..34-)
(/note="EGF-like-)
Interpro:  IPR013032  IPR000742  IPR003961  IPR036116  IPR007110  
IPR036179  IPR013783  IPR011009  IPR000719  IPR017441  IPR001245  IPR018941  IPR008266  IPR020635  
Prosite:   PS00022 PS01186 PS50026 PS50853 PS50835 PS00107 PS50011 PS00109
CDD:   cd00063

PDB:  
1FVR 2GY5 2GY7 2OO8 2OSC 2P4I 2WQB 3BEA 3L8P 4K0V 4X3J 5MYA 5MYB 5UTK 6MWE
PDBsum:   1FVR 2GY5 2GY7 2OO8 2OSC 2P4I 2WQB 3BEA 3L8P 4K0V 4X3J 5MYA 5MYB 5UTK 6MWE

DIP:  

6047

MINT:  
STRING:   ENSP00000369375
Other Databases GeneCards:  TEK  Malacards:  TEK

Gene ontology

Expand All | Collapse All

GO accessionTerm nameEvidence codeGo category
GO:0005515 protein binding
IPI molecular function
GO:0001934 positive regulation of pr
otein phosphorylation
IMP biological process
GO:0043235 receptor complex
IBA cellular component
GO:0033674 positive regulation of ki
nase activity
IBA biological process
GO:0014068 positive regulation of ph
osphatidylinositol 3-kina
se signaling
IBA biological process
GO:0010595 positive regulation of en
dothelial cell migration
IBA biological process
GO:0004714 transmembrane receptor pr
otein tyrosine kinase act
ivity
IBA molecular function
GO:0001525 angiogenesis
IBA biological process
GO:0051897 positive regulation of pr
otein kinase B signaling
IBA biological process
GO:0045766 positive regulation of an
giogenesis
IBA biological process
GO:0043410 positive regulation of MA
PK cascade
IBA biological process
GO:0007275 multicellular organism de
velopment
IBA biological process
GO:0007169 transmembrane receptor pr
otein tyrosine kinase sig
naling pathway
IBA biological process
GO:0005887 integral component of pla
sma membrane
IBA cellular component
GO:0001935 endothelial cell prolifer
ation
IBA biological process
GO:0046777 protein autophosphorylati
on
IDA biological process
GO:0018108 peptidyl-tyrosine phospho
rylation
IDA biological process
GO:0010595 positive regulation of en
dothelial cell migration
IDA biological process
GO:0005911 cell-cell junction
IDA cellular component
GO:0004713 protein tyrosine kinase a
ctivity
IDA molecular function
GO:0048014 Tie signaling pathway
IDA biological process
GO:0048014 Tie signaling pathway
IDA biological process
GO:0045766 positive regulation of an
giogenesis
IDA biological process
GO:0009925 basal plasma membrane
IDA cellular component
GO:0007169 transmembrane receptor pr
otein tyrosine kinase sig
naling pathway
IDA biological process
GO:0005887 integral component of pla
sma membrane
IDA cellular component
GO:0005884 actin filament
IDA colocalizes with
GO:0001934 positive regulation of pr
otein phosphorylation
IDA biological process
GO:0001725 stress fiber
IDA colocalizes with
GO:2000351 regulation of endothelial
cell apoptotic process
TAS biological process
GO:0060216 definitive hemopoiesis
TAS biological process
GO:0043552 positive regulation of ph
osphatidylinositol 3-kina
se activity
IMP biological process
GO:0043552 positive regulation of ph
osphatidylinositol 3-kina
se activity
IMP biological process
GO:0043114 regulation of vascular pe
rmeability
TAS biological process
GO:0043114 regulation of vascular pe
rmeability
TAS biological process
GO:0043066 negative regulation of ap
optotic process
TAS biological process
GO:0032878 regulation of establishme
nt or maintenance of cell
polarity
IMP biological process
GO:0016525 negative regulation of an
giogenesis
IMP biological process
GO:0014068 positive regulation of ph
osphatidylinositol 3-kina
se signaling
IMP biological process
GO:0014068 positive regulation of ph
osphatidylinositol 3-kina
se signaling
IMP biological process
GO:0014068 positive regulation of ph
osphatidylinositol 3-kina
se signaling
IMP biological process
GO:0010595 positive regulation of en
dothelial cell migration
IMP biological process
GO:0010595 positive regulation of en
dothelial cell migration
IMP biological process
GO:0002040 sprouting angiogenesis
IMP biological process
GO:0001525 angiogenesis
ISS biological process
GO:2000352 negative regulation of en
dothelial cell apoptotic
process
ISS biological process
GO:2000251 positive regulation of ac
tin cytoskeleton reorgani
zation
IMP biological process
GO:1902533 positive regulation of in
tracellular signal transd
uction
IMP biological process
GO:0070374 positive regulation of ER
K1 and ERK2 cascade
IMP biological process
GO:0060347 heart trabecula formation
ISS biological process
GO:0051897 positive regulation of pr
otein kinase B signaling
IMP biological process
GO:0051894 positive regulation of fo
cal adhesion assembly
IMP biological process
GO:0050728 negative regulation of in
flammatory response
TAS biological process
GO:0045766 positive regulation of an
giogenesis
IMP biological process
GO:0034446 substrate adhesion-depend
ent cell spreading
IMP biological process
GO:0007507 heart development
ISS biological process
GO:0005515 protein binding
IPI molecular function
GO:0001938 positive regulation of en
dothelial cell proliferat
ion
TAS biological process
GO:0001935 endothelial cell prolifer
ation
ISS biological process
GO:0001934 positive regulation of pr
otein phosphorylation
IMP biological process
GO:0004713 protein tyrosine kinase a
ctivity
IEA molecular function
GO:0004714 transmembrane receptor pr
otein tyrosine kinase act
ivity
IEA molecular function
GO:0004672 protein kinase activity
IEA molecular function
GO:0005524 ATP binding
IEA molecular function
GO:0005887 integral component of pla
sma membrane
IEA cellular component
GO:0006468 protein phosphorylation
IEA biological process
GO:0007169 transmembrane receptor pr
otein tyrosine kinase sig
naling pathway
IEA biological process
GO:0005576 extracellular region
IEA cellular component
GO:0001525 angiogenesis
IEA biological process
GO:0004713 protein tyrosine kinase a
ctivity
IEA molecular function
GO:0016301 kinase activity
IEA molecular function
GO:0016740 transferase activity
IEA molecular function
GO:0030054 cell junction
IEA cellular component
GO:0005737 cytoplasm
IEA cellular component
GO:0005524 ATP binding
IEA molecular function
GO:0005886 plasma membrane
IEA cellular component
GO:0016020 membrane
IEA cellular component
GO:0016021 integral component of mem
brane
IEA cellular component
GO:0016310 phosphorylation
IEA biological process
GO:0000166 nucleotide binding
IEA molecular function
GO:0005856 cytoskeleton
IEA cellular component
GO:0004672 protein kinase activity
TAS molecular function
GO:0004714 transmembrane receptor pr
otein tyrosine kinase act
ivity
TAS molecular function
GO:0038023 signaling receptor activi
ty
TAS molecular function
GO:0005887 integral component of pla
sma membrane
TAS cellular component
GO:0007169 transmembrane receptor pr
otein tyrosine kinase sig
naling pathway
TAS biological process
GO:0007165 signal transduction
TAS biological process
GO:0007267 cell-cell signaling
TAS biological process
GO:0004714 transmembrane receptor pr
otein tyrosine kinase act
ivity
IEA molecular function
GO:0000165 MAPK cascade
TAS biological process
GO:0005886 plasma membrane
TAS cellular component
GO:0005886 plasma membrane
TAS cellular component
GO:0005886 plasma membrane
TAS cellular component
GO:0005886 plasma membrane
TAS cellular component
GO:0005886 plasma membrane
TAS cellular component
GO:0005886 plasma membrane
TAS cellular component
GO:0005886 plasma membrane
TAS cellular component
GO:0005886 plasma membrane
TAS cellular component
GO:0005886 plasma membrane
TAS cellular component
GO:0005886 plasma membrane
TAS cellular component
GO:0005886 plasma membrane
TAS cellular component
GO:0005886 plasma membrane
TAS cellular component
GO:0005886 plasma membrane
TAS cellular component
GO:0005886 plasma membrane
TAS cellular component
GO:0004713 protein tyrosine kinase a
ctivity
TAS molecular function
GO:0050900 leukocyte migration
TAS biological process
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0001666 response to hypoxia
IEA biological process
GO:0001958 endochondral ossification
IEA biological process
GO:0010033 response to organic subst
ance
IEA biological process
GO:0043627 response to estrogen
IEA biological process
GO:0019838 growth factor binding
IEA molecular function
GO:0043434 response to peptide hormo
ne
IEA biological process
GO:0045766 positive regulation of an
giogenesis
IEA biological process
GO:0051591 response to cAMP
IEA biological process
GO:0072012 glomerulus vasculature de
velopment
IEA biological process
GO:0005576 extracellular region
IEA cellular component
GO:0030054 cell junction
IEA cellular component
GO:0005925 focal adhesion
IEA cellular component
GO:0005886 plasma membrane
IEA cellular component
GO:0005856 cytoskeleton
IEA cellular component
GO:0005886 plasma membrane
IDA cellular component
GO:0034451 centriolar satellite
IDA cellular component
GO:0016323 basolateral plasma membra
ne
IDA cellular component
GO:0070374 positive regulation of ER
K1 and ERK2 cascade
IDA biological process
GO:0009986 cell surface
IDA cellular component
GO:0045121 membrane raft
IDA cellular component
GO:0005902 microvillus
IDA cellular component
GO:0051897 positive regulation of pr
otein kinase B signaling
IDA biological process
GO:0016324 apical plasma membrane
IDA cellular component
GO:0042802 identical protein binding
IPI molecular function
GO:0072012 glomerulus vasculature de
velopment
ISS biological process
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function

KEGG pathways

Expand All | Collapse All

Pathway idPathway name
hsa04151PI3K-Akt signaling pathway
hsa04010MAPK signaling pathway
hsa04014Ras signaling pathway
hsa04015Rap1 signaling pathway
hsa04066HIF-1 signaling pathway
hsa05323Rheumatoid arthritis
Associated diseases References
Venous malformations KEGG:H00531
Cutaneous and mucosal venous malformation KEGG:H02044
Venous malformations KEGG:H00531
Cutaneous and mucosal venous malformation KEGG:H02044
Arteriovenous malformation PMID:8980225
Coronary artery disease PMID:12814387
Pulmonary hypertension PMID:16917117
Teratozoospermia MIK: 17327269

PubMed references

Expand All | Collapse All

PMID Condition Mutation Ethnicity Population details Infertility_type Associated_genes Abstract
17327269 Teratozoos
permia

13 (5 controls,
8 cases)
Male infertility GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
Show abstract