• Gene id: 7010

Gene Summary

• Gene Symbol: TEK   Gene   UCSC   Ensembl
• Aliases: CD202B, GLC3E, TIE-2, TIE2, VMCM, VMCM1
• Gene name: TEK receptor tyrosine kinase
• Alternate names: angiopoietin-1 receptor, TEK tyrosine kinase, endothelial, endothelial tyrosine kinase, tunica interna endothelial cell kinase, tyrosine kinase with Ig and EGF homology domains-2, tyrosine-protein kinase receptor TEK, tyrosine-protein kinase receptor TIE-2,
• Gene location: 9p21.2 (27109140: 27230177)     Exons: 23     NC_000009.12
• Gene summary(Entrez): This gene encodes a receptor that belongs to the protein tyrosine kinase Tie2 family. The encoded protein possesses a unique extracellular region that contains two immunoglobulin-like domains, three epidermal growth factor (EGF)-like domains and three fib
• OMIM: 600221

Protein Summary

• Protein general information: Q02763  
  • Name: Angiopoietin 1 receptor (EC 2.7.10.1) (Endothelial tyrosine kinase) (Tunica interna endothelial cell kinase) (Tyrosine kinase with Ig and EGF homology domains 2) (Tyrosine protein kinase receptor TEK) (Tyrosine protein kinase receptor TIE 2) (hTIE2) (p140
  • Length: 1124  
  • Mass: 125830
  • Tissue specificity: Detected in umbilical vein endothelial cells. Proteolytic processing gives rise to a soluble extracellular domain that is detected in blood plasma (at protein level). Predominantly expressed in endothelial cells and their progenitors,
• Sequence:

  MDSLASLVLCGVSLLLSGTVEGAMDLILINSLPLVSDAETSLTCIASGWRPHEPITIGRDFEALMNQHQDPLEVT
  QDVTREWAKKVVWKREKASKINGAYFCEGRVRGEAIRIRTMKMRQQASFLPATLTMTVDKGDNVNISFKKVLIKE
  EDAVIYKNGSFIHSVPRHEVPDILEVHLPHAQPQDAGVYSARYIGGNLFTSAFTRLIVRRCEAQKWGPECNHLCT
  ACMNNGVCHEDTGECICPPGFMGRTCEKACELHTFGRTCKERCSGQEGCKSYVFCLPDPYGCSCATGWKGLQCNE
  ACHPGFYGPDCKLRCSCNNGEMCDRFQGCLCSPGWQGLQCEREGIQRMTPKIVDLPDHIEVNSGKFNPICKASGW
  PLPTNEEMTLVKPDGTVLHPKDFNHTDHFSVAIFTIHRILPPDSGVWVCSVNTVAGMVEKPFNISVKVLPKPLNA
  PNVIDTGHNFAVINISSEPYFGDGPIKSKKLLYKPVNHYEAWQHIQVTNEIVTLNYLEPRTEYELCVQLVRRGEG
  GEGHPGPVRRFTTASIGLPPPRGLNLLPKSQTTLNLTWQPIFPSSEDDFYVEVERRSVQKSDQQNIKVPGNLTSV
  LLNNLHPREQYVVRARVNTKAQGEWSEDLTAWTLSDILPPQPENIKISNITHSSAVISWTILDGYSISSITIRYK
  VQGKNEDQHVDVKIKNATITQYQLKGLEPETAYQVDIFAENNIGSSNPAFSHELVTLPESQAPADLGGGKMLLIA
  ILGSAGMTCLTVLLAFLIILQLKRANVQRRMAQAFQNVREEPAVQFNSGTLALNRKVKNNPDPTIYPVLDWNDIK
  FQDVIGEGNFGQVLKARIKKDGLRMDAAIKRMKEYASKDDHRDFAGELEVLCKLGHHPNIINLLGACEHRGYLYL
  AIEYAPHGNLLDFLRKSRVLETDPAFAIANSTASTLSSQQLLHFAADVARGMDYLSQKQFIHRDLAARNILVGEN
  YVAKIADFGLSRGQEVYVKKTMGRLPVRWMAIESLNYSVYTTNSDVWSYGVLLWEIVSLGGTPYCGMTCAELYEK
  LPQGYRLEKPLNCDDEVYDLMRQCWREKPYERPSFAQILVSLNRMLEERKTYVNTTLYEKFTYAGIDCSAEEAA

• Structural information:
  • Protein Domains: (44..12-)
    1 (/note="Ig-like-C2-type)
    (210..25-)
    (/note="EGF-like-1)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00076-)
    (254..29-)
    (/note="EGF-like-2)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00076-)
    (301..34-)
    (/note="EGF-like-)
  • Interpro: IPR013032  IPR000742  IPR003961  IPR036116  IPR007110   IPR036179  IPR013783  IPR011009  IPR000719  IPR017441  IPR001245  IPR018941  IPR008266  IPR020635  
  • Prosite: PS00022 PS01186 PS50026 PS50853 PS50835 PS00107 PS50011 PS00109
  • CDD: cd00063
  • PDB: 1FVR 2GY5 2GY7 2OO8 2OSC 2P4I 2WQB 3BEA 3L8P 4K0V 4X3J 5MYA 5MYB 5UTK 6MWE
  • PDBsum: 1FVR 2GY5 2GY7 2OO8 2OSC 2P4I 2WQB 3BEA 3L8P 4K0V 4X3J 5MYA 5MYB 5UTK 6MWE
  • DIP: 6047
  • STRING: ENSP00000369375
• Other Databases: GeneCards:  TEK  Malacards:  TEK

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005515	protein binding	IPI	molecular function
GO:0001934	positive regulation of protein phosphorylation	IMP	biological process
GO:0043235	receptor complex	IBA	cellular component
GO:0033674	positive regulation of kinase activity	IBA	biological process
GO:0014068	positive regulation of phosphatidylinositol 3-kinase signaling	IBA	biological process
GO:0010595	positive regulation of endothelial cell migration	IBA	biological process
GO:0004714	transmembrane receptor protein tyrosine kinase activity	IBA	molecular function
GO:0001525	angiogenesis	IBA	biological process
GO:0051897	positive regulation of protein kinase B signaling	IBA	biological process
GO:0045766	positive regulation of angiogenesis	IBA	biological process
GO:0043410	positive regulation of MAPK cascade	IBA	biological process
GO:0007275	multicellular organism development	IBA	biological process
GO:0007169	transmembrane receptor protein tyrosine kinase signaling pathway	IBA	biological process
GO:0005887	integral component of plasma membrane	IBA	cellular component
GO:0001935	endothelial cell proliferation	IBA	biological process
GO:0046777	protein autophosphorylation	IDA	biological process
GO:0018108	peptidyl-tyrosine phosphorylation	IDA	biological process
GO:0010595	positive regulation of endothelial cell migration	IDA	biological process
GO:0005911	cell-cell junction	IDA	cellular component
GO:0004713	protein tyrosine kinase activity	IDA	molecular function
GO:0048014	Tie signaling pathway	IDA	biological process
GO:0048014	Tie signaling pathway	IDA	biological process
GO:0045766	positive regulation of angiogenesis	IDA	biological process
GO:0009925	basal plasma membrane	IDA	cellular component
GO:0007169	transmembrane receptor protein tyrosine kinase signaling pathway	IDA	biological process
GO:0005887	integral component of plasma membrane	IDA	cellular component
GO:0005884	actin filament	IDA	colocalizes with
GO:0001934	positive regulation of protein phosphorylation	IDA	biological process
GO:0001725	stress fiber	IDA	colocalizes with
GO:2000351	regulation of endothelial cell apoptotic process	TAS	biological process
GO:0060216	definitive hemopoiesis	TAS	biological process
GO:0043552	positive regulation of phosphatidylinositol 3-kinase activity	IMP	biological process
GO:0043552	positive regulation of phosphatidylinositol 3-kinase activity	IMP	biological process
GO:0043114	regulation of vascular permeability	TAS	biological process
GO:0043114	regulation of vascular permeability	TAS	biological process
GO:0043066	negative regulation of apoptotic process	TAS	biological process
GO:0032878	regulation of establishment or maintenance of cell polarity	IMP	biological process
GO:0016525	negative regulation of angiogenesis	IMP	biological process
GO:0014068	positive regulation of phosphatidylinositol 3-kinase signaling	IMP	biological process
GO:0014068	positive regulation of phosphatidylinositol 3-kinase signaling	IMP	biological process
GO:0014068	positive regulation of phosphatidylinositol 3-kinase signaling	IMP	biological process
GO:0010595	positive regulation of endothelial cell migration	IMP	biological process
GO:0010595	positive regulation of endothelial cell migration	IMP	biological process
GO:0002040	sprouting angiogenesis	IMP	biological process
GO:0001525	angiogenesis	ISS	biological process
GO:2000352	negative regulation of endothelial cell apoptotic process	ISS	biological process
GO:2000251	positive regulation of actin cytoskeleton reorganization	IMP	biological process
GO:1902533	positive regulation of intracellular signal transduction	IMP	biological process
GO:0070374	positive regulation of ERK1 and ERK2 cascade	IMP	biological process
GO:0060347	heart trabecula formation	ISS	biological process
GO:0051897	positive regulation of protein kinase B signaling	IMP	biological process
GO:0051894	positive regulation of focal adhesion assembly	IMP	biological process
GO:0050728	negative regulation of inflammatory response	TAS	biological process
GO:0045766	positive regulation of angiogenesis	IMP	biological process
GO:0034446	substrate adhesion-dependent cell spreading	IMP	biological process
GO:0007507	heart development	ISS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0001938	positive regulation of endothelial cell proliferation	TAS	biological process
GO:0001935	endothelial cell proliferation	ISS	biological process
GO:0001934	positive regulation of protein phosphorylation	IMP	biological process
GO:0004713	protein tyrosine kinase activity	IEA	molecular function
GO:0004714	transmembrane receptor protein tyrosine kinase activity	IEA	molecular function
GO:0004672	protein kinase activity	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0005887	integral component of plasma membrane	IEA	cellular component
GO:0006468	protein phosphorylation	IEA	biological process
GO:0007169	transmembrane receptor protein tyrosine kinase signaling pathway	IEA	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0001525	angiogenesis	IEA	biological process
GO:0004713	protein tyrosine kinase activity	IEA	molecular function
GO:0016301	kinase activity	IEA	molecular function
GO:0016740	transferase activity	IEA	molecular function
GO:0030054	cell junction	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005524	ATP binding	IEA	molecular function
GO:0005886	plasma membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016310	phosphorylation	IEA	biological process
GO:0000166	nucleotide binding	IEA	molecular function
GO:0005856	cytoskeleton	IEA	cellular component
GO:0004672	protein kinase activity	TAS	molecular function
GO:0004714	transmembrane receptor protein tyrosine kinase activity	TAS	molecular function
GO:0038023	signaling receptor activity	TAS	molecular function
GO:0005887	integral component of plasma membrane	TAS	cellular component
GO:0007169	transmembrane receptor protein tyrosine kinase signaling pathway	TAS	biological process
GO:0007165	signal transduction	TAS	biological process
GO:0007267	cell-cell signaling	TAS	biological process
GO:0004714	transmembrane receptor protein tyrosine kinase activity	IEA	molecular function
GO:0000165	MAPK cascade	TAS	biological process
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0004713	protein tyrosine kinase activity	TAS	molecular function
GO:0050900	leukocyte migration	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0001666	response to hypoxia	IEA	biological process
GO:0001958	endochondral ossification	IEA	biological process
GO:0010033	response to organic substance	IEA	biological process
GO:0043627	response to estrogen	IEA	biological process
GO:0019838	growth factor binding	IEA	molecular function
GO:0043434	response to peptide hormone	IEA	biological process
GO:0045766	positive regulation of angiogenesis	IEA	biological process
GO:0051591	response to cAMP	IEA	biological process
GO:0072012	glomerulus vasculature development	IEA	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0030054	cell junction	IEA	cellular component
GO:0005925	focal adhesion	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005856	cytoskeleton	IEA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0034451	centriolar satellite	IDA	cellular component
GO:0016323	basolateral plasma membrane	IDA	cellular component
GO:0070374	positive regulation of ERK1 and ERK2 cascade	IDA	biological process
GO:0009986	cell surface	IDA	cellular component
GO:0045121	membrane raft	IDA	cellular component
GO:0005902	microvillus	IDA	cellular component
GO:0051897	positive regulation of protein kinase B signaling	IDA	biological process
GO:0016324	apical plasma membrane	IDA	cellular component
GO:0042802	identical protein binding	IPI	molecular function
GO:0072012	glomerulus vasculature development	ISS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function

KEGG pathways

Pathway id	Pathway name
hsa04151	PI3K-Akt signaling pathway
hsa04010	MAPK signaling pathway
hsa04014	Ras signaling pathway
hsa04015	Rap1 signaling pathway
hsa04066	HIF-1 signaling pathway
hsa05323	Rheumatoid arthritis

Diseases

Associated diseases	References
Venous malformations	KEGG:H00531
Cutaneous and mucosal venous malformation	KEGG:H02044
Venous malformations	KEGG:H00531
Cutaneous and mucosal venous malformation	KEGG:H02044
Arteriovenous malformation	PMID:8980225
Coronary artery disease	PMID:12814387
Pulmonary hypertension	PMID:16917117
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)