• Gene id: 7009

Gene Summary

• Gene Symbol: TMBIM6   Gene   UCSC   Ensembl
• Aliases: BAXI1, BI-1, TEGT
• Gene name: transmembrane BAX inhibitor motif containing 6
• Alternate names: bax inhibitor 1, testis enhanced gene transcript, testis-enhanced gene transcript protein, transmembrane BAX inhibitor motif-containing protein 6,
• Gene location: 12q13.12 (44576824: 44432142)     Exons: 9     NC_000013.11
• OMIM: 600748

Protein Summary

• Protein general information: P55061  
  • Name: Bax inhibitor 1 (BI 1) (Testis enhanced gene transcript protein) (Transmembrane BAX inhibitor motif containing protein 6)
  • Length: 237  
  • Mass: 26538
  • Tissue specificity: Highly abundant in testis. {ECO
• Sequence:

  MNIFDRKINFDALLKFSHITPSTQQHLKKVYASFALCMFVAAAGAYVHMVTHFIQAGLLSALGSLILMIWLMATP
  HSHETEQKRLGLLAGFAFLTGVGLGPALEFCIAVNPSILPTAFMGTAMIFTCFTLSALYARRRSYLFLGGILMSA
  LSLLLLSSLGNVFFGSIWLFQANLYVGLVVMCGFVLFDTQLIIEKAEHGDQDYIWHCIDLFLDFITVFRKLMMIL
  AMNEKDKKKEKK

• Structural information:
  • Interpro: IPR006213  IPR006214  
  • Prosite: PS01243
  • STRING: ENSP00000389277
• Other Databases: GeneCards:  TMBIM6  Malacards:  TMBIM6

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0060698	endoribonuclease inhibitor activity	IDA	molecular function
GO:1903298	negative regulation of hypoxia-induced intrinsic apoptotic signaling pathway	IDA	biological process
GO:0005789	endoplasmic reticulum membrane	IDA	cellular component
GO:0005783	endoplasmic reticulum	IDA	cellular component
GO:0005783	endoplasmic reticulum	IDA	cellular component
GO:0031625	ubiquitin protein ligase binding	IPI	molecular function
GO:1902236	negative regulation of endoplasmic reticulum stress-induced intrinsic apoptotic signaling pathway	IDA	biological process
GO:0060702	negative regulation of endoribonuclease activity	IDA	biological process
GO:0033119	negative regulation of RNA splicing	IDA	biological process
GO:1902065	response to L-glutamate	IDA	biological process
GO:0043066	negative regulation of apoptotic process	IGI	biological process
GO:0032091	negative regulation of protein binding	IDA	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005737	cytoplasm	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0019899	enzyme binding	IPI	molecular function
GO:0031966	mitochondrial membrane	IDA	cellular component
GO:2001234	negative regulation of apoptotic signaling pathway	IDA	biological process
GO:0034620	cellular response to unfolded protein	IDA	biological process
GO:0016021	integral component of membrane	NAS	cellular component
GO:0043066	negative regulation of apoptotic process	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0006986	response to unfolded protein	IEA	biological process
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0006914	autophagy	IEA	biological process
GO:0006915	apoptotic process	IEA	biological process
GO:0005634	nucleus	TAS	cellular component
GO:0005887	integral component of plasma membrane	TAS	cellular component
GO:0005783	endoplasmic reticulum	TAS	cellular component
GO:0010523	negative regulation of calcium ion transport into cytosol	IDA	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:1902236	negative regulation of endoplasmic reticulum stress-induced intrinsic apoptotic signaling pathway	IEA	biological process
GO:0070059	intrinsic apoptotic signaling pathway in response to endoplasmic reticulum stress	IEA	biological process
GO:0060702	negative regulation of endoribonuclease activity	IEA	biological process
GO:0060698	endoribonuclease inhibitor activity	IEA	molecular function
GO:0033119	negative regulation of RNA splicing	IEA	biological process
GO:1990441	negative regulation of transcription from RNA polymerase II promoter in response to endoplasmic reticulum stress	IEA	biological process
GO:0051025	negative regulation of immunoglobulin secretion	IEA	biological process
GO:0034976	response to endoplasmic reticulum stress	IEA	biological process
GO:0034620	cellular response to unfolded protein	IEA	biological process
GO:0032469	endoplasmic reticulum calcium ion homeostasis	IEA	biological process
GO:0019899	enzyme binding	IEA	molecular function
GO:0005789	endoplasmic reticulum membrane	IEA	cellular component
GO:0016020	membrane	HDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa05130	Pathogenic Escherichia coli infection

Diseases

Associated diseases	References
Prostate cancer	PMID:12875974
Cervical squamous cell carcinoma	PMID:15337562
Teratozoospermia	MIK: 17327269
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray