• Gene id: 7006

Gene Summary

• Gene Symbol: TEC   Gene   UCSC   Ensembl
• Aliases: PSCTK4
• Gene name: tec protein tyrosine kinase
• Alternate names: tyrosine-protein kinase Tec,
• Gene location: 4p12-p11 (48269863: 48135782)     Exons: 35     NC_000004.12
• Gene summary(Entrez): The protein encoded by this gene belongs to the Tec family of non-receptor protein-tyrosine kinases containing a pleckstrin homology domain. Tec family kinases are involved in the intracellular signaling mechanisms of cytokine receptors, lymphocyte surfac
• OMIM: 600583

Protein Summary

• Protein general information: P42680  
  • Name: Tyrosine protein kinase Tec (EC 2.7.10.2)
  • Length: 631  
  • Mass: 73581
  • Tissue specificity: Expressed in a wide range of cells, including hematopoietic cell lines like myeloid, B-, and T-cell lineages.
• Sequence:

  MNFNTILEEILIKRSQQKKKTSPLNYKERLFVLTKSMLTYYEGRAEKKYRKGFIDVSKIKCVEIVKNDDGVIPCQ
  NKYPFQVVHDANTLYIFAPSPQSRDLWVKKLKEEIKNNNNIMIKYHPKFWTDGSYQCCRQTEKLAPGCEKYNLFE
  SSIRKALPPAPETKKRRPPPPIPLEEEDNSEEIVVAMYDFQAAEGHDLRLERGQEYLILEKNDVHWWRARDKYGN
  EGYIPSNYVTGKKSNNLDQYEWYCRNMNRSKAEQLLRSEDKEGGFMVRDSSQPGLYTVSLYTKFGGEGSSGFRHY
  HIKETTTSPKKYYLAEKHAFGSIPEIIEYHKHNAAGLVTRLRYPVSVKGKNAPTTAGFSYEKWEINPSELTFMRE
  LGSGLFGVVRLGKWRAQYKVAIKAIREGAMCEEDFIEEAKVMMKLTHPKLVQLYGVCTQQKPIYIVTEFMERGCL
  LNFLRQRQGHFSRDVLLSMCQDVCEGMEYLERNSFIHRDLAARNCLVSEAGVVKVSDFGMARYVLDDQYTSSSGA
  KFPVKWCPPEVFNYSRFSSKSDVWSFGVLMWEVFTEGRMPFEKYTNYEVVTMVTRGHRLYQPKLASNYVYEVMLR
  CWQEKPEGRPSFEDLLRTIDELVECEETFGR

• Structural information:
  • Protein Domains: (4..11-)
    (/note="PH-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00145-)
    (179..23-)
    (/note="SH3-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00192-)
    (247..34-)
    (/note="SH2-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00191-)
    (370..-)
  • Interpro: IPR011009  IPR011993  IPR001849  IPR000719  IPR017441   IPR001245  IPR000980  IPR036860  IPR036028  IPR001452  IPR035572  IPR008266  IPR020635  IPR001562  
  • Prosite: PS50003 PS00107 PS50011 PS00109 PS50001 PS50002 PS51113
  • CDD: cd11905
  • PDB: 2LUL
  • PDBsum: 2LUL
  • STRING: ENSP00000370912
• Other Databases: GeneCards:  TEC  Malacards:  TEC

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0002250	adaptive immune response	IBA	biological process
GO:0042246	tissue regeneration	IBA	biological process
GO:0050852	T cell receptor signaling pathway	IBA	biological process
GO:0004715	non-membrane spanning protein tyrosine kinase activity	IBA	molecular function
GO:0007229	integrin-mediated signaling pathway	IBA	biological process
GO:0010543	regulation of platelet activation	IBA	biological process
GO:0038083	peptidyl-tyrosine autophosphorylation	IBA	biological process
GO:0050853	B cell receptor signaling pathway	IBA	biological process
GO:0050853	B cell receptor signaling pathway	IDA	biological process
GO:0010543	regulation of platelet activation	IDA	biological process
GO:0010543	regulation of platelet activation	IDA	biological process
GO:0007229	integrin-mediated signaling pathway	IDA	biological process
GO:0004715	non-membrane spanning protein tyrosine kinase activity	IDA	molecular function
GO:0005856	cytoskeleton	IDA	cellular component
GO:0005856	cytoskeleton	IDA	cellular component
GO:0004713	protein tyrosine kinase activity	IEA	molecular function
GO:0004672	protein kinase activity	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0006468	protein phosphorylation	IEA	biological process
GO:0035556	intracellular signal transduction	IEA	biological process
GO:0016301	kinase activity	IEA	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0008289	lipid binding	IEA	molecular function
GO:0004713	protein tyrosine kinase activity	IEA	molecular function
GO:0002376	immune system process	IEA	biological process
GO:0016740	transferase activity	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0000166	nucleotide binding	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0005524	ATP binding	IEA	molecular function
GO:0005856	cytoskeleton	IEA	cellular component
GO:0002250	adaptive immune response	IEA	biological process
GO:0016310	phosphorylation	IEA	biological process
GO:0004715	non-membrane spanning protein tyrosine kinase activity	TAS	molecular function
GO:0006468	protein phosphorylation	TAS	biological process
GO:0035556	intracellular signal transduction	TAS	biological process
GO:0004715	non-membrane spanning protein tyrosine kinase activity	IEA	molecular function
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0019221	cytokine-mediated signaling pathway	TAS	biological process
GO:0038095	Fc-epsilon receptor signaling pathway	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0042246	tissue regeneration	IEA	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0018108	peptidyl-tyrosine phosphorylation	IDA	biological process
GO:0004715	non-membrane spanning protein tyrosine kinase activity	IDA	molecular function
GO:0005543	phospholipid binding	NAS	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0050731	positive regulation of peptidyl-tyrosine phosphorylation	IDA	biological process
GO:0038083	peptidyl-tyrosine autophosphorylation	IMP	biological process
GO:0005856	cytoskeleton	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005886	plasma membrane	IDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04380	Osteoclast differentiation
hsa04660	T cell receptor signaling pathway

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)