• Gene id: 7005

Gene Summary

• Gene Symbol: TEAD3   Gene   UCSC   Ensembl
• Aliases: DTEF-1, ETFR-1, TEAD-3, TEAD5, TEF-5, TEF5
• Gene name: TEA domain transcription factor 3
• Alternate names: transcriptional enhancer factor TEF-5, TEA domain family member 3, TEA domain family member 5, transcriptional enhancer factor 5, transcriptional enhancer factor TEF-5 (DTEF-1),
• Gene location: 6p21.31 (35497078: 35473596)     Exons: 13     NC_000006.12
• Gene summary(Entrez): This gene product is a member of the transcriptional enhancer factor (TEF) family of transcription factors, which contain the TEA/ATTS DNA-binding domain. It is predominantly expressed in the placenta and is involved in the transactivation of the chorioni
• OMIM: 188450

Protein Summary

• Protein general information: Q99594  
  • Name: Transcriptional enhancer factor TEF 5 (DTEF 1) (TEA domain family member 3) (TEAD 3)
  • Length: 435  
  • Mass: 48676
  • Tissue specificity: Preferentially expressed in the placenta.
• Sequence:

  MASNSWNASSSPGEAREDGPEGLDKGLDNDAEGVWSPDIEQSFQEALAIYPPCGRRKIILSDEGKMYGRNELIAR
  YIKLRTGKTRTRKQVSSHIQVLARKKVREYQVGIKAMNLDQVSKDKALQSMASMSSAQIVSASVLQNKFSPPSPL
  PQAVFSTSSRFWSSPPLLGQQPGPSQDIKPFAQPAYPIQPPLPPTLSSYEPLAPLPSAAASVPVWQDRTIASSRL
  RLLEYSAFMEVQRDPDTYSKHLFVHIGQTNPAFSDPPLEAVDVRQIYDKFPEKKGGLKELYEKGPPNAFFLVKFW
  ADLNSTIQEGPGAFYGVSSQYSSADSMTISVSTKVCSFGKQVVEKVETEYARLENGRFVYRIHRSPMCEYMINFI
  HKLKHLPEKYMMNSVLENFTILQVVTSRDSQETLLVIAFVFEVSTSEHGAQHHVYKLVKD

• Structural information:
  • Interpro: IPR000818  IPR038096  IPR027253  IPR016361  IPR041086  
  • Prosite: PS00554 PS51088
  • PDB: 5EMW
  • PDBsum: 5EMW
  • DIP: 50657
  • STRING: ENSP00000345772
• Other Databases: GeneCards:  TEAD3  Malacards:  TEAD3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000790	nuclear chromatin	ISA	cellular component
GO:0000981	DNA-binding transcription factor activity, RNA polymerase II-specific	ISM	molecular function
GO:0000981	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA	molecular function
GO:0000978	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IBA	molecular function
GO:0001228	DNA-binding transcription activator activity, RNA polymerase II-specific	IBA	molecular function
GO:0035329	hippo signaling	IBA	biological process
GO:0005634	nucleus	IBA	cellular component
GO:0005667	transcription regulator complex	IBA	cellular component
GO:0045944	positive regulation of transcription by RNA polymerase II	IBA	biological process
GO:0048568	embryonic organ development	IBA	biological process
GO:0035329	hippo signaling	IDA	biological process
GO:0035329	hippo signaling	IDA	biological process
GO:0003700	DNA-binding transcription factor activity	IDA	molecular function
GO:0003700	DNA-binding transcription factor activity	IDA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0003700	DNA-binding transcription factor activity	IEA	molecular function
GO:0035329	hippo signaling	IEA	biological process
GO:0006355	regulation of transcription, DNA-templated	IEA	biological process
GO:0045944	positive regulation of transcription by RNA polymerase II	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0003677	DNA binding	IEA	molecular function
GO:0006357	regulation of transcription by RNA polymerase II	TAS	biological process
GO:0007565	female pregnancy	TAS	biological process
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0006367	transcription initiation from RNA polymerase II promoter	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0001085	RNA polymerase II transcription factor binding	IPI	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0055059	asymmetric neuroblast division	IGI	biological process

KEGG pathways

Pathway id	Pathway name
hsa04390	Hippo signaling pathway
hsa04392	Hippo signaling pathway - multiple species

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq