• Gene id: 7001

Gene Summary

• Gene Symbol: PRDX2   Gene   UCSC   Ensembl
• Aliases: HEL-S-2a, NKEF-B, NKEFB, PRP, PRX2, PRXII, PTX1, TDPX1, TPX1, TSA
• Gene name: peroxiredoxin 2
• Alternate names: peroxiredoxin-2, epididymis secretory sperm binding protein Li 2a, natural killer cell-enhancing factor B, thiol-specific antioxidant 1, thioredoxin peroxidase 1, thioredoxin-dependent peroxide reductase 1, torin,
• Gene location: 19p13.13 (12801909: 12796819)     Exons: 6     NC_000019.10
• Gene summary(Entrez): This gene encodes a member of the peroxiredoxin family of antioxidant enzymes, which reduce hydrogen peroxide and alkyl hydroperoxides. The encoded protein plays an antioxidant protective role in cells, and it may contribute to the antiviral activity of C
• OMIM: 600538

Protein Summary

• Protein general information: P32119  
  • Name: Peroxiredoxin 2 (EC 1.11.1.15) (Natural killer cell enhancing factor B) (NKEF B) (PRP) (Thiol specific antioxidant protein) (TSA) (Thioredoxin peroxidase 1) (Thioredoxin dependent peroxide reductase 1)
  • Length: 198  
  • Mass: 21,892
• Sequence:

  MASGNARIGKPAPDFKATAVVDGAFKEVKLSDYKGKYVVLFFYPLDFTFVCPTEIIAFSNRAEDFRKLGCEVLGV
  SVDSQFTHLAWINTPRKEGGLGPLNIPLLADVTRRLSEDYGVLKTDEGIAYRGLFIIDGKGVLRQITVNDLPVGR
  SVDEALRLVQAFQYTDEHGEVCPAGWKPGSDTIKPNVDDSKEYFSKHN

• Structural information:
  • Protein Domains: Thioredoxin. (6-164)
  • Interpro: IPR000866  IPR024706  IPR019479  IPR036249  IPR013766  
  • Prosite: PS51352
  • PDB: 1QMV 5B8A 5B8B 5IJT
  • PDBsum: 1QMV 5B8A 5B8B 5IJT
  • DIP: 39882
  • STRING: ENSP00000301522
• Other Databases: GeneCards:  PRDX2  Malacards:  PRDX2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000302	response to reactive oxygen species	TAS	biological process
GO:0005737	cytoplasm	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0006979	response to oxidative stress	NAS	biological process
GO:0006979	response to oxidative stress	IMP	biological process
GO:0008379	thioredoxin peroxidase activity	EXP	molecular function
GO:0008379	thioredoxin peroxidase activity	EXP	molecular function
GO:0008379	thioredoxin peroxidase activity	EXP	molecular function
GO:0008379	thioredoxin peroxidase activity	TAS	molecular function
GO:0008379	thioredoxin peroxidase activity	IDA	molecular function
GO:0016209	antioxidant activity	NAS	molecular function
GO:0016209	antioxidant activity	IDA	molecular function
GO:0019430	removal of superoxide radicals	IDA	biological process
GO:0034599	cellular response to oxidative stress	IDA	biological process
GO:0042744	hydrogen peroxide catabolic process	TAS	biological process
GO:0042981	regulation of apoptotic process	IMP	biological process
GO:0043066	negative regulation of apoptotic process	TAS	biological process
GO:0043524	negative regulation of neuron apoptotic process	IEA	biological process
GO:0055114	oxidation-reduction process	IEA	biological process
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0000302	response to reactive oxygen species	TAS	biological process
GO:0004601	peroxidase activity	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005737	cytoplasm	TAS	cellular component
GO:0005829	cytosol	IEA	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0006979	response to oxidative stress	IEA	biological process
GO:0006979	response to oxidative stress	NAS	biological process
GO:0006979	response to oxidative stress	IMP	biological process
GO:0008379	thioredoxin peroxidase activity	IEA	molecular function
GO:0008379	thioredoxin peroxidase activity	EXP	molecular function
GO:0008379	thioredoxin peroxidase activity	EXP	molecular function
GO:0008379	thioredoxin peroxidase activity	EXP	molecular function
GO:0008379	thioredoxin peroxidase activity	TAS	molecular function
GO:0008379	thioredoxin peroxidase activity	IDA	molecular function
GO:0016209	antioxidant activity	IEA	molecular function
GO:0016209	antioxidant activity	IEA	molecular function
GO:0016209	antioxidant activity	NAS	molecular function
GO:0016209	antioxidant activity	IDA	molecular function
GO:0016491	oxidoreductase activity	IEA	molecular function
GO:0016491	oxidoreductase activity	IEA	molecular function
GO:0019430	removal of superoxide radicals	IEA	biological process
GO:0019430	removal of superoxide radicals	IDA	biological process
GO:0034599	cellular response to oxidative stress	IDA	biological process
GO:0042744	hydrogen peroxide catabolic process	TAS	biological process
GO:0042981	regulation of apoptotic process	IMP	biological process
GO:0043066	negative regulation of apoptotic process	TAS	biological process
GO:0043524	negative regulation of neuron apoptotic process	IEA	biological process
GO:0051920	peroxiredoxin activity	IEA	molecular function
GO:0051920	peroxiredoxin activity	IEA	molecular function
GO:0055114	oxidation-reduction process	IEA	biological process
GO:0055114	oxidation-reduction process	IEA	biological process
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0000302	response to reactive oxygen species	TAS	biological process
GO:0005737	cytoplasm	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0006979	response to oxidative stress	NAS	biological process
GO:0006979	response to oxidative stress	IMP	biological process
GO:0008379	thioredoxin peroxidase activity	EXP	molecular function
GO:0008379	thioredoxin peroxidase activity	EXP	molecular function
GO:0008379	thioredoxin peroxidase activity	EXP	molecular function
GO:0008379	thioredoxin peroxidase activity	TAS	molecular function
GO:0008379	thioredoxin peroxidase activity	IDA	molecular function
GO:0016209	antioxidant activity	NAS	molecular function
GO:0016209	antioxidant activity	IDA	molecular function
GO:0019430	removal of superoxide radicals	IDA	biological process
GO:0034599	cellular response to oxidative stress	IDA	biological process
GO:0042744	hydrogen peroxide catabolic process	TAS	biological process
GO:0042981	regulation of apoptotic process	IMP	biological process
GO:0043066	negative regulation of apoptotic process	TAS	biological process
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component

Diseases

Associated diseases	References
Oligoasthenoteratospermia	MIK: 16759931
Spermatogenesis defects	MIK: 16759931
Spermatogenesis defects	MIK: 14985855
Male factor infertility	MIK: 16759931
Associated with sperm after capacitation and AR, and is relevant for sperm-oocyte interaction	MIK: 15734896
Sperm motility defects	MIK: 14985855
Male infertility	MIK: 16759931
Oligoasthenoteratospermia syndrome	MIK: 16759931
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
14985855	Impaired sperm motility			53 (29 normal, 24 motility impaired)	Male infertility	TPX-1 LDHC
16759931	Spermatogenic arrest, male infertility, oligoasthenoteratospermia syndrome				Male infertility	TPX1
15734896	Associated with sperm after capacitation and AR, and is relevant for sperm-oocyte interaction				Male infertility
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
31037746	Spermatogenic defects			28 men with azoospermia	Male infertility	Microarray