• Gene id: 6997

Gene Summary

• Gene Symbol: TDGF1   Gene   UCSC   Ensembl
• Aliases: CR, CR-1, CRGF, CRIPTO
• Gene name: teratocarcinoma-derived growth factor 1
• Alternate names: teratocarcinoma-derived growth factor 1, cripto-1 growth factor, epidermal growth factor-like cripto protein CR1,
• Gene location: 3p21.31 (46574534: 46582456)     Exons: 7     NC_000003.12
• Gene summary(Entrez): This gene encodes an epidermal growth factor-related protein that contains a cripto, FRL-1, and cryptic domain. The encoded protein is an extracellular, membrane-bound signaling protein that plays an essential role in embryonic development and tumor growt
• OMIM: 187395

Protein Summary

• Protein general information: P13385  
  • Name: Teratocarcinoma derived growth factor 1 (Cripto 1 growth factor) (CRGF) (Epidermal growth factor like cripto protein CR1)
  • Length: 188  
  • Mass: 21169
  • Tissue specificity: Preferentially expressed in gastric and colorectal carcinomas than in their normal counterparts. Expressed in breast and lung. {ECO
• Sequence:

  MDCRKMARFSYSVIWIMAISKVFELGLVAGLGHQEFARPSRGYLAFRDDSIWPQEEPAIRPRSSQRVPPMGIQHS
  KELNRTCCLNGGTCMLGSFCACPPSFYGRNCEHDVRKENCGSVPHDTWLPKKCSLCKCWHGQLRCFPQAFLPGCD
  GLVMDEHLVASRTPELPPSARTTTFMLVGICLSIQSYY

• Structural information:
  • Protein Domains: (78..10-)
    (/note="EGF-like-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00076"-)
  • Interpro: IPR017047  IPR019011  IPR013032  IPR000742  
  • Prosite: PS00022 PS50026
  • STRING: ENSP00000296145
• Other Databases: GeneCards:  TDGF1  Malacards:  TDGF1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005515	protein binding	IPI	molecular function
GO:0005576	extracellular region	IBA	cellular component
GO:0009952	anterior/posterior pattern specification	IBA	biological process
GO:0038092	nodal signaling pathway	IBA	biological process
GO:0038100	nodal binding	IBA	molecular function
GO:0001568	blood vessel development	IBA	biological process
GO:0005102	signaling receptor binding	IBA	molecular function
GO:0007368	determination of left/right symmetry	IBA	biological process
GO:0007507	heart development	IBA	biological process
GO:0009986	cell surface	IBA	cellular component
GO:0048856	anatomical structure development	IBA	biological process
GO:0070697	activin receptor binding	IBA	molecular function
GO:0008083	growth factor activity	IEA	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0008083	growth factor activity	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0031225	anchored component of membrane	IEA	cellular component
GO:0008284	positive regulation of cell population proliferation	IDA	biological process
GO:0000187	activation of MAPK activity	IDA	biological process
GO:0008083	growth factor activity	IDA	molecular function
GO:0007173	epidermal growth factor receptor signaling pathway	IDA	NOT|biological process
GO:0005886	plasma membrane	TAS	cellular component
GO:0035019	somatic stem cell population maintenance	TAS	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0050731	positive regulation of peptidyl-tyrosine phosphorylation	IDA	biological process
GO:0035729	cellular response to hepatocyte growth factor stimulus	IDA	biological process
GO:0030335	positive regulation of cell migration	IDA	biological process
GO:0005615	extracellular space	IDA	cellular component
GO:0016324	apical plasma membrane	IDA	cellular component
GO:0009986	cell surface	IDA	cellular component
GO:0009966	regulation of signal transduction	IDA	biological process
GO:0007507	heart development	IDA	biological process
GO:0071356	cellular response to tumor necrosis factor	IDA	biological process
GO:0071346	cellular response to interferon-gamma	IDA	biological process
GO:0045121	membrane raft	IDA	cellular component
GO:0044344	cellular response to fibroblast growth factor stimulus	IDA	biological process
GO:0043066	negative regulation of apoptotic process	IDA	biological process
GO:0018105	peptidyl-serine phosphorylation	IDA	biological process
GO:0010595	positive regulation of endothelial cell migration	IDA	biological process
GO:0000187	activation of MAPK activity	IDA	biological process
GO:0071364	cellular response to epidermal growth factor stimulus	IDA	biological process
GO:0071354	cellular response to interleukin-6	IDA	biological process
GO:0008083	growth factor activity	IDA	molecular function
GO:0005102	signaling receptor binding	IDA	molecular function
GO:0008595	anterior/posterior axis specification, embryo	ISS	biological process
GO:0002042	cell migration involved in sprouting angiogenesis	IMP	biological process
GO:0030154	cell differentiation	TAS	biological process
GO:0019897	extrinsic component of plasma membrane	ISS	cellular component
GO:0008284	positive regulation of cell population proliferation	TAS	biological process
GO:0001763	morphogenesis of a branching structure	TAS	biological process
GO:0030879	mammary gland development	TAS	biological process
GO:0009792	embryo development ending in birth or egg hatching	TAS	biological process

Diseases

Associated diseases	References
Congenital heart disease	PMID:19853938
colon cancer	PMID:15173016
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881