• Gene id: 6996

Gene Summary

• Gene Symbol: TDG   Gene   UCSC   Ensembl
• Aliases: hTDG
• Gene name: thymine DNA glycosylase
• Alternate names: G/T mismatch-specific thymine DNA glycosylase,
• Gene location: 12q23.3 (50693586: 50733076)     Exons: 18     NC_000016.10
• Gene summary(Entrez): The protein encoded by this gene belongs to the TDG/mug DNA glycosylase family. Thymine-DNA glycosylase (TDG) removes thymine moieties from G/T mismatches by hydrolyzing the carbon-nitrogen bond between the sugar-phosphate backbone of DNA and the mispaire
• OMIM: 601423

Protein Summary

• Protein general information: Q13569  
  • Name: G/T mismatch specific thymine DNA glycosylase (EC 3.2.2.29) (Thymine DNA glycosylase) (hTDG)
  • Length: 410  
  • Mass: 46053
• Sequence:

  MEAENAGSYSLQQAQAFYTFPFQQLMAEAPNMAVVNEQQMPEEVPAPAPAQEPVQEAPKGRKRKPRTTEPKQPVE
  PKKPVESKKSGKSAKSKEKQEKITDTFKVKRKVDRFNGVSEAELLTKTLPDILTFNLDIVIIGINPGLMAAYKGH
  HYPGPGNHFWKCLFMSGLSEVQLNHMDDHTLPGKYGIGFTNMVERTTPGSKDLSSKEFREGGRILVQKLQKYQPR
  IAVFNGKCIYEIFSKEVFGVKVKNLEFGLQPHKIPDTETLCYVMPSSSARCAQFPRAQDKVHYYIKLKDLRDQLK
  GIERNMDVQEVQYTFDLQLAQEDAKKMAVKEEKYDPGYEAAYGGAYGENPCSSEPCGFSSNGLIESVELRGESAF
  SGIPNGQWMTQSFTDQIPSFSNHCGTQEQEEESHA

• Structural information:
  • Interpro: IPR015637  IPR003310  IPR005122  IPR036895  
  • CDD: cd10028
  • PDB: 1WYW 2D07 2RBA 3UFJ 3UO7 3UOB 4FNC 4JGC 4XEG 4Z3A 4Z47 4Z7B 4Z7Z 5CYS 5FF8 5HF7 5JXY 5T2W 6U15 6U16 6U17
  • PDBsum: 1WYW 2D07 2RBA 3UFJ 3UO7 3UOB 4FNC 4JGC 4XEG 4Z3A 4Z47 4Z7B 4Z7Z 5CYS 5FF8 5HF7 5JXY 5T2W 6U15 6U16 6U17
  • DIP: 32709
  • STRING: ENSP00000376611
• Other Databases: GeneCards:  TDG  Malacards:  TDG

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0008263	pyrimidine-specific mismatch base pair DNA N-glycosylase activity	IBA	molecular function
GO:0006285	base-excision repair, AP site formation	IBA	biological process
GO:0005634	nucleus	IBA	cellular component
GO:0004844	uracil DNA N-glycosylase activity	IBA	molecular function
GO:0042803	protein homodimerization activity	IDA	molecular function
GO:0019104	DNA N-glycosylase activity	IDA	molecular function
GO:0019104	DNA N-glycosylase activity	IDA	molecular function
GO:0006298	mismatch repair	IDA	biological process
GO:0006284	base-excision repair	IDA	biological process
GO:0006284	base-excision repair	IDA	biological process
GO:0003690	double-stranded DNA binding	IDA	molecular function
GO:0030983	mismatched DNA binding	IDA	molecular function
GO:0008263	pyrimidine-specific mismatch base pair DNA N-glycosylase activity	IDA	molecular function
GO:0008263	pyrimidine-specific mismatch base pair DNA N-glycosylase activity	IDA	molecular function
GO:0005634	nucleus	IDA	cellular component
GO:0040029	regulation of gene expression, epigenetic	ISS	biological process
GO:0080111	DNA demethylation	ISS	biological process
GO:0003677	DNA binding	ISS	molecular function
GO:0045995	regulation of embryonic development	ISS	biological process
GO:0006281	DNA repair	IEA	biological process
GO:0019104	DNA N-glycosylase activity	IEA	molecular function
GO:0016787	hydrolase activity	IEA	molecular function
GO:0006325	chromatin organization	IEA	biological process
GO:0006281	DNA repair	IEA	biological process
GO:0006974	cellular response to DNA damage stimulus	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0003684	damaged DNA binding	TAS	molecular function
GO:0005654	nucleoplasm	TAS	cellular component
GO:0006284	base-excision repair	TAS	biological process
GO:0035511	oxidative DNA demethylation	TAS	biological process
GO:0035511	oxidative DNA demethylation	TAS	biological process
GO:0045008	depyrimidination	TAS	biological process
GO:0045008	depyrimidination	TAS	biological process
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0019104	DNA N-glycosylase activity	TAS	molecular function
GO:0019104	DNA N-glycosylase activity	TAS	molecular function
GO:0019104	DNA N-glycosylase activity	TAS	molecular function
GO:0019104	DNA N-glycosylase activity	TAS	molecular function
GO:0019104	DNA N-glycosylase activity	TAS	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005080	protein kinase C binding	IEA	molecular function
GO:0006284	base-excision repair	IEA	biological process
GO:0019104	DNA N-glycosylase activity	IEA	molecular function
GO:0032091	negative regulation of protein binding	IEA	biological process
GO:0032183	SUMO binding	IEA	molecular function
GO:0040029	regulation of gene expression, epigenetic	IEA	biological process
GO:0000122	negative regulation of transcription by RNA polymerase II	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0008134	transcription factor binding	IEA	molecular function
GO:0019904	protein domain specific binding	IEA	molecular function
GO:0000122	negative regulation of transcription by RNA polymerase II	IEA	biological process
GO:0003677	DNA binding	IEA	molecular function
GO:0003712	transcription coregulator activity	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0016605	PML body	IEA	cellular component
GO:0035562	negative regulation of chromatin binding	IEA	biological process
GO:0045995	regulation of embryonic development	IEA	biological process
GO:0080111	DNA demethylation	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0006285	base-excision repair, AP site formation	IDA	biological process
GO:1902544	regulation of DNA N-glycosylase activity	IMP	biological process
GO:0003690	double-stranded DNA binding	IDA	molecular function
GO:0003690	double-stranded DNA binding	IDA	molecular function
GO:0006285	base-excision repair, AP site formation	IMP	biological process
GO:0005634	nucleus	IDA	cellular component
GO:0043739	G/U mismatch-specific uracil-DNA glycosylase activity	IMP	molecular function
GO:0032183	SUMO binding	IPI	molecular function
GO:0008263	pyrimidine-specific mismatch base pair DNA N-glycosylase activity	IMP	molecular function
GO:0000287	magnesium ion binding	IDA	molecular function
GO:0031402	sodium ion binding	IDA	molecular function
GO:0004844	uracil DNA N-glycosylase activity	IDA	molecular function
GO:0008263	pyrimidine-specific mismatch base pair DNA N-glycosylase activity	IDA	molecular function
GO:0043621	protein self-association	IDA	molecular function
GO:0005524	ATP binding	IDA	molecular function
GO:0030983	mismatched DNA binding	IDA	molecular function
GO:0030983	mismatched DNA binding	IDA	molecular function
GO:0030983	mismatched DNA binding	IDA	molecular function
GO:0030983	mismatched DNA binding	IDA	molecular function
GO:0031404	chloride ion binding	IDA	molecular function

KEGG pathways

Pathway id	Pathway name
hsa03410	Base excision repair

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)