• Gene id: 6993

Gene Summary

• Gene Symbol: DYNLT1   Gene   UCSC   Ensembl
• Aliases: CW-1, TCTEL1, tctex-1
• Gene name: dynein light chain Tctex-type 1
• Alternate names: dynein light chain Tctex-type 1, T-complex testis-specific protein 1 homolog, t-complex-associated-testis-expressed 1-like 1,
• Gene location: 6q25.3 (158644785: 158636473)     Exons: 5     NC_000006.12
• Gene summary(Entrez): This gene encodes a component of the motor complex, cytoplasmic dynein, which transports cellular cargo along microtubules in the cell. The encoded protein regulates the length of primary cilia which are sensory organelles found on the surface of cells. T
• OMIM: 601554

Protein Summary

• Protein general information: P63172  
  • Name: Dynein light chain Tctex type 1 (Protein CW 1) (T complex testis specific protein 1 homolog)
  • Length: 113  
  • Mass: 12,452
• Sequence:

  MEDYQAAEETAFVVDEVSNIVKEAIESAIGGNAYQHSKVNQWTTNVVEQTLSQLTKLGKPFKYIVTCVIMQKNGA
  GLHTASSCFWDSSTDGSCTVRWENKTMYCIVSAFGLSI

• Structural information:
  • Interpro: IPR005334  IPR038586  
  • PDB: 5JPW
  • PDBsum: 5JPW
  • DIP: 35251
  • STRING: ENSP00000356056
• Other Databases: GeneCards:  DYNLT1  Malacards:  DYNLT1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000132	establishment of mitotic spindle orientation	ISS	biological process
GO:0003774	motor activity	IEA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0005819	spindle	IEA	cellular component
GO:0005868	cytoplasmic dynein complex	ISS	cellular component
GO:0005868	cytoplasmic dynein complex	ISS	cellular component
GO:0005881	cytoplasmic microtubule	IDA	cellular component
GO:0007067	mitotic nuclear division	IEA	biological process
GO:0008277	regulation of G-protein coupled receptor protein signaling pathway	ISS	biological process
GO:0019060	intracellular transport of viral protein in host cell	IMP	biological process
GO:0042802	identical protein binding	IPI	molecular function
GO:0043087	regulation of GTPase activity	IEA	biological process
GO:0043657	host cell	IEA	cellular component
GO:0046718	viral entry into host cell	IEA	biological process
GO:0048812	neuron projection morphogenesis	IEA	biological process
GO:0050768	negative regulation of neurogenesis	ISS	biological process
GO:0051301	cell division	IEA	biological process
GO:0051493	regulation of cytoskeleton organization	IEA	biological process
GO:0075521	microtubule-dependent intracellular transport of viral material towards nucleus	IEA	biological process
GO:0099503	secretory vesicle	IDA	cellular component
GO:0000132	establishment of mitotic spindle orientation	ISS	biological process
GO:0003774	motor activity	IEA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0005819	spindle	IEA	cellular component
GO:0005856	cytoskeleton	IEA	cellular component
GO:0005868	cytoplasmic dynein complex	ISS	cellular component
GO:0005868	cytoplasmic dynein complex	ISS	cellular component
GO:0005874	microtubule	IEA	cellular component
GO:0005881	cytoplasmic microtubule	IDA	cellular component
GO:0006810	transport	IEA	biological process
GO:0007049	cell cycle	IEA	biological process
GO:0007067	mitotic nuclear division	IEA	biological process
GO:0007399	nervous system development	IEA	biological process
GO:0008277	regulation of G-protein coupled receptor protein signaling pathway	ISS	biological process
GO:0016032	viral process	IEA	biological process
GO:0019060	intracellular transport of viral protein in host cell	IMP	biological process
GO:0030286	dynein complex	IEA	cellular component
GO:0042802	identical protein binding	IPI	molecular function
GO:0043087	regulation of GTPase activity	IEA	biological process
GO:0043657	host cell	IEA	cellular component
GO:0046718	viral entry into host cell	IEA	biological process
GO:0048812	neuron projection morphogenesis	IEA	biological process
GO:0050768	negative regulation of neurogenesis	ISS	biological process
GO:0051301	cell division	IEA	biological process
GO:0051493	regulation of cytoskeleton organization	IEA	biological process
GO:0075521	microtubule-dependent intracellular transport of viral material towards nucleus	IEA	biological process
GO:0075606	transport of viral material towards nucleus	IEA	biological process
GO:0099503	secretory vesicle	IDA	cellular component
GO:0000132	establishment of mitotic spindle orientation	ISS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005868	cytoplasmic dynein complex	ISS	cellular component
GO:0005868	cytoplasmic dynein complex	ISS	cellular component
GO:0005881	cytoplasmic microtubule	IDA	cellular component
GO:0008277	regulation of G-protein coupled receptor protein signaling pathway	ISS	biological process
GO:0019060	intracellular transport of viral protein in host cell	IMP	biological process
GO:0042802	identical protein binding	IPI	molecular function
GO:0050768	negative regulation of neurogenesis	ISS	biological process
GO:0099503	secretory vesicle	IDA	cellular component

Diseases

Associated diseases	References
Male factor infertility	MIK: 26432663
Male factor infertility	MIK: 26432663
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
26432663	Male factor infertility			72 (14 fertile men, 15 asthenozoospermic men, 20 oligozoospermic men, 23 teratozoospermic men)	Male infertility
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)