• Gene id: 6992

Gene Summary

• Gene Symbol: PPP1R11   Gene   UCSC   Ensembl
• Aliases: CFAP255, HCG-V, HCGV, IPP3, TCTE5, TCTEX5
• Gene name: protein phosphatase 1 regulatory inhibitor subunit 11
• Alternate names: E3 ubiquitin-protein ligase PPP1R11, HCG V, hemochromatosis candidate gene V protein, inhibitor-3, protein phosphatase 1 regulatory subunit 11, protein phosphatase 1, regulatory (inhibitor) subunit 11, protein phosphatase inhibitor 3, t-complex-associated-testis,
• Gene location: 6p22.1 (30066863: 30070332)     Exons: 4     NC_000006.12
• Gene summary(Entrez): This gene encodes a specific inhibitor of protein phosphatase-1 (PP1) with a differential sensitivity toward the metal-independent and metal-dependent forms of PP1. The gene is located within the major histocompatibility complex class I region on chromoso
• OMIM: 612037

Protein Summary

• Protein general information: O60927  
  • Name: E3 ubiquitin protein ligase PPP1R11 (EC 2.3.2.27) (Hemochromatosis candidate gene V protein) (HCG V) (Protein phosphatase 1 regulatory subunit 11) (Protein phosphatase inhibitor 3)
  • Length: 126  
  • Mass: 13953
  • Tissue specificity: Widely expressed. {ECO
• Sequence:

  MAEAGAGLSETVTETTVTVTTEPENRSLTIKLRKRKPEKKVEWTSDTVDNEHMGRRSSKCCCIYEKPRAFGESST
  ESDEEEEEGCGHTHCVRGHRKGRRRATLGPTPTTPPQPPDPSQPPPGPMQH

• Structural information:
  • Interpro: IPR011107  
  • STRING: ENSP00000365963
• Other Databases: GeneCards:  PPP1R11  Malacards:  PPP1R11

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0035308	negative regulation of protein dephosphorylation	IBA	biological process
GO:0008157	protein phosphatase 1 binding	IBA	molecular function
GO:0032515	negative regulation of phosphoprotein phosphatase activity	IBA	biological process
GO:0005634	nucleus	IBA	cellular component
GO:0004865	protein serine/threonine phosphatase inhibitor activity	IBA	molecular function
GO:0061630	ubiquitin protein ligase activity	IDA	molecular function
GO:0050830	defense response to Gram-positive bacterium	ISS	biological process
GO:0050710	negative regulation of cytokine secretion	ISS	biological process
GO:0006511	ubiquitin-dependent protein catabolic process	IMP	biological process
GO:0004865	protein serine/threonine phosphatase inhibitor activity	IEA	molecular function
GO:0032515	negative regulation of phosphoprotein phosphatase activity	IEA	biological process
GO:0016740	transferase activity	IEA	molecular function
GO:0004864	protein phosphatase inhibitor activity	IEA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0016567	protein ubiquitination	IEA	biological process
GO:0005737	cytoplasm	ISS	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881