• Gene id: 6990

Gene Summary

• Gene Symbol: DYNLT3   Gene   UCSC   Ensembl
• Aliases: RP3, TCTE1L, TCTEX1L
• Gene name: dynein light chain Tctex-type 3
• Alternate names: dynein light chain Tctex-type 3, protein 91/23,
• Gene location: Xp11.4 (103493704: 103592545)     Exons: 12     NC_000010.11
• Gene summary(Entrez): This gene encodes a member of a subclass of dynein light chains. The encoded protein homodimerizes and forms the light chain component of the cytoplasmic dynein motor protein complex. This protein may be important for binding dynein to specific cargos inc
• OMIM: 300302

Protein Summary

• Protein general information: P51808  
  • Name: Dynein light chain Tctex type 3 (Protein 91/23) (T complex associated testis expressed 1 like)
  • Length: 116  
  • Mass: 13062
• Sequence:

  MEEYHRHCDEVGFNAEEAHNIVKECVDGVLGGEDYNHNNINQWTASIVEQSLTHLVKLGKAYKYIVTCAVVQKSA
  YGFHTASSCFWDTTSDGTCTVRWENRTMNCIVNVFAIAIVL

• Structural information:
  • Interpro: IPR005334  IPR038586  
  • STRING: ENSP00000367841
• Other Databases: GeneCards:  DYNLT3  Malacards:  DYNLT3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000776	kinetochore	IDA	colocalizes with
GO:0007346	regulation of mitotic cell cycle	ISS	biological process
GO:0030286	dynein complex	IEA	cellular component
GO:0003774	motor activity	IEA	molecular function
GO:0051301	cell division	IEA	biological process
GO:0000776	kinetochore	IEA	cellular component
GO:0005856	cytoskeleton	IEA	cellular component
GO:0007049	cell cycle	IEA	biological process
GO:0000775	chromosome, centromeric region	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005874	microtubule	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005694	chromosome	IEA	cellular component
GO:0042802	identical protein binding	IPI	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0042802	identical protein binding	IEA	molecular function
GO:0007346	regulation of mitotic cell cycle	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0061673	mitotic spindle astral microtubule	IEA	cellular component
GO:0045931	positive regulation of mitotic cell cycle	IEA	biological process
GO:0005868	cytoplasmic dynein complex	IEA	cellular component
GO:0000776	kinetochore	IEA	cellular component
GO:0000777	condensed chromosome kinetochore	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005856	cytoskeleton	IEA	cellular component
GO:0005868	cytoplasmic dynein complex	IDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa05132	Salmonella infection

Diseases

Associated diseases	References
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R