• Gene id: 6988

Gene Summary

• Gene Symbol: TCTA   Gene   UCSC   Ensembl
• Gene name: T cell leukemia translocation altered
• Alternate names: T-cell leukemia translocation-altered gene protein, T-cell leukemia translocation-associated gene protein,
• Gene location: 3p21.31 (69452817: 69456204)     Exons: 4     NC_000015.10
• OMIM: 600690

Protein Summary

• Protein general information: P57738  
  • Name: T cell leukemia translocation altered gene protein (T cell leukemia translocation associated gene protein)
  • Length: 103  
  • Mass: 11341
  • Tissue specificity: Ubiquitous. Highest level of expression in kidney. Present in monocytes, osteoclasts, macrophages, synoviocytes and synovial lining cells (at protein level). {ECO
• Sequence:

  MAESWSGQALQALPATVLGALGSEFLREWEAQDMRVTLFKLLLLWLVLSLLGIQLAWGFYGNTVTGLYHRPGLGG
  QNGSTPDGSTHFPSWEMAANEPLKTHRE

• Structural information:
  • Interpro: IPR016560  
  • STRING: ENSP00000273590
• Other Databases: GeneCards:  TCTA  Malacards:  TCTA

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0072675	osteoclast fusion	IDA	biological process
GO:0045671	negative regulation of osteoclast differentiation	IDA	biological process
GO:0003674	molecular_function	ND	molecular function
GO:0072675	osteoclast fusion	IBA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0016020	membrane	IEA	cellular component

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)