• Gene id: 6950

Gene Summary

• Gene Symbol: TCP1   Gene   UCSC   Ensembl
• Aliases: CCT-alpha, CCT1, CCTa, D6S230E, TCP-1-alpha
• Gene name: t-complex 1
• Alternate names: T-complex protein 1 subunit alpha, T-complex protein 1, alpha subunit, t-complex 1 protein, tailless complex polypeptide 1,
• Gene location: 6q25.3 (159789702: 159778497)     Exons: 12     NC_000006.12
• Gene summary(Entrez): The protein encoded by this gene is a molecular chaperone that is a member of the chaperonin containing TCP1 complex (CCT), also known as the TCP1 ring complex (TRiC). This complex consists of two identical stacked rings, each containing eight different p
• OMIM: 186980

Protein Summary

• Protein general information: P17987  
  • Name: T complex protein 1 subunit alpha (TCP 1 alpha) (CCT alpha)
  • Length: 556  
  • Mass: 60344
• Sequence:

  MEGPLSVFGDRSTGETIRSQNVMAAASIANIVKSSLGPVGLDKMLVDDIGDVTITNDGATILKLLEVEHPAAKVL
  CELADLQDKEVGDGTTSVVIIAAELLKNADELVKQKIHPTSVISGYRLACKEAVRYINENLIVNTDELGRDCLIN
  AAKTSMSSKIIGINGDFFANMVVDAVLAIKYTDIRGQPRYPVNSVNILKAHGRSQMESMLISGYALNCVVGSQGM
  PKRIVNAKIACLDFSLQKTKMKLGVQVVITDPEKLDQIRQRESDITKERIQKILATGANVILTTGGIDDMCLKYF
  VEAGAMAVRRVLKRDLKRIAKASGATILSTLANLEGEETFEAAMLGQAEEVVQERICDDELILIKNTKARTSASI
  ILRGANDFMCDEMERSLHDALCVVKRVLESKSVVPGGGAVEAALSIYLENYATSMGSREQLAIAEFARSLLVIPN
  TLAVNAAQDSTDLVAKLRAFHNEAQVNPERKNLKWIGLDLSNGKPRDNKQAGVFEPTIVKVKSLKFATEAAITIL
  RIDDLIKLHPESKDDKHGSYEDAVHSGALND

• Structural information:
  • Interpro: IPR012715  IPR017998  IPR002194  IPR002423  IPR027409   IPR027413  IPR027410  
  • Prosite: PS00750 PS00751 PS00995
  • CDD: cd03335
  • PDB: 6NR8 6NR9 6NRA 6NRB 6NRC 6NRD 6QB8
  • PDBsum: 6NR8 6NR9 6NRA 6NRB 6NRC 6NRD 6QB8
  • DIP: 33676
  • STRING: ENSP00000317334
• Other Databases: GeneCards:  TCP1  Malacards:  TCP1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0031625	ubiquitin protein ligase binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005832	chaperonin-containing T-complex	IBA	cellular component
GO:0005832	chaperonin-containing T-complex	IDA	cellular component
GO:0006457	protein folding	IEA	biological process
GO:0051082	unfolded protein binding	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0000166	nucleotide binding	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0005856	cytoskeleton	IEA	cellular component
GO:0051082	unfolded protein binding	TAS	molecular function
GO:0005829	cytosol	TAS	cellular component
GO:0006457	protein folding	TAS	biological process
GO:0005813	centrosome	IDA	cellular component
GO:0035722	interleukin-12-mediated signaling pathway	TAS	biological process
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0006457	protein folding	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:2000109	regulation of macrophage apoptotic process	IEA	biological process
GO:0044053	translocation of peptides or proteins into host cell cytoplasm	IEA	biological process
GO:0007339	binding of sperm to zona pellucida	IEA	biological process
GO:0005815	microtubule organizing center	IEA	cellular component
GO:0001669	acrosomal vesicle	IEA	cellular component
GO:1901998	toxin transport	IEA	biological process
GO:0044297	cell body	IEA	cellular component
GO:0005832	chaperonin-containing T-complex	IEA	cellular component
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0005720	nuclear heterochromatin	IEA	cellular component
GO:0002199	zona pellucida receptor complex	IEA	cellular component
GO:0000242	pericentriolar material	IEA	cellular component
GO:0000792	heterochromatin	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:1904851	positive regulation of establishment of protein localization to telomere	IMP	biological process
GO:0090666	scaRNA localization to Cajal body	IMP	biological process
GO:0090666	scaRNA localization to Cajal body	IMP	biological process
GO:1904874	positive regulation of telomerase RNA localization to Cajal body	HMP	biological process
GO:0032212	positive regulation of telomere maintenance via telomerase	IMP	biological process
GO:1904871	positive regulation of protein localization to Cajal body	HMP	biological process
GO:0050821	protein stabilization	IMP	biological process
GO:0090666	scaRNA localization to Cajal body	IMP	biological process
GO:0051973	positive regulation of telomerase activity	IMP	biological process
GO:0005832	chaperonin-containing T-complex	IDA	cellular component
GO:1904874	positive regulation of telomerase RNA localization to Cajal body	IMP	biological process
GO:1904851	positive regulation of establishment of protein localization to telomere	IMP	biological process
GO:0005829	cytosol	IEA	cellular component
GO:0005815	microtubule organizing center	IEA	cellular component
GO:0005874	microtubule	IDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0007021	tubulin complex assembly	NAS	biological process
GO:0003723	RNA binding	HDA	molecular function

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)